Biosystem for Modulation of Interactions between Antigen-Presenting Cells and T Cells

Biosystems Design by Machine Studying

Biosystems corresponding to enzymes, pathways, and complete cells have been more and more explored for biotechnological functions. Nevertheless, the intricate connectivity and ensuing complexity of biosystems poses a significant hurdle in designing biosystems with fascinating options. As -omics and different excessive throughput applied sciences have been quickly developed, the promise of making use of machine studying (ML) strategies in biosystems design has began to change into a actuality.

  • ML fashions allow the identification of patterns inside sophisticated organic information throughout a number of scales of study and might increase biosystems design functions by predicting new candidates for optimized efficiency.
  • ML is getting used at each stage of biosystems design to assist discover nonobvious engineering options with fewer design iterations. On this overview, we first describe generally used fashions and modeling paradigms inside ML.
  • We then focus on some functions of those fashions which have already proven success in biotechnological functions.
  • Furthermore, we focus on profitable functions in any respect scales of biosystems design, together with nucleic acids, genetic circuits, proteins, pathways, genomes, and bioprocesses. Lastly, we focus on some limitations of those strategies and potential options in addition to prospects of the mixture of ML and biosystems design.
DKK-1 (HEK293-expressed), Human
HY-P7155A 50ug
EUR 843
Recombinant Human DKK-1 Protein
PROTO94907-3 10ug
EUR 317
Description: DKK-1 is a member of the DKK protein family which also includes DKK-2, DKK-3 and DKK-4. DKK-1 was originally identified as a Xenopus head forming molecule that behaves as an antagonist for Wnt signaling. Subsequent studies have shown that DKK-1 and DKK-4 play an important regulatory role in the Wnt /β-catenin signaling pathway by forming inhibitory complexes with LDL receptor-related proteins 5 and 6 (LRP5 and LRP6), which are essential components of the Wnt/βcatenin signaling system. LPR5 and LPR6 are single-pass transmembrane proteins that appear to act as co-receptors for Wnt ligands involved in the Wnt/βcatenin signaling cascade. It has been suggested that by inhibiting Wnt/β-catenin signaling, which is essential for posterior patterning in vertebrates, DKK-1 permits anterior development. This notion is supported by the finding that mice deficient of DKK-1 expression lack head formation and die during embryogenesis. Recombinant human DKK-1 expressed in human 293 cells is a 35-40 kDa glycoprotein containing 235 amino-acid residues.
Human DKK-1 ELISA kit
LF-EK50797 1×96T
EUR 648
Dkk-1 Polyclonal Antibody
ES4292-100ul 100ul
EUR 279
Description: A Rabbit Polyclonal antibody against Dkk-1 from Human/Mouse/Rat. This antibody is tested and validated for WB, ELISA, IHC, WB, ELISA
Dkk-1 Polyclonal Antibody
ES4292-50ul 50ul
EUR 207
Description: A Rabbit Polyclonal antibody against Dkk-1 from Human/Mouse/Rat. This antibody is tested and validated for WB, ELISA, IHC, WB, ELISA
Dkk-1 Polyclonal Antibody
ABP53293-003ml 0.03ml
EUR 158
  • Immunogen information: Synthesized peptide derived from the C-terminal region of human Dkk-1
  • Applications tips:
Description: A polyclonal antibody for detection of Dkk-1 from Human, Mouse, Rat. This Dkk-1 antibody is for WB, IHC-P, ELISA. It is affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific immunogenand is unconjugated. The antibody is produced in rabbit by using as an immunogen synthesized peptide derived from the C-terminal region of human Dkk-1
Dkk-1 Polyclonal Antibody
ABP53293-01ml 0.1ml
EUR 289
  • Immunogen information: Synthesized peptide derived from the C-terminal region of human Dkk-1
  • Applications tips:
Description: A polyclonal antibody for detection of Dkk-1 from Human, Mouse, Rat. This Dkk-1 antibody is for WB, IHC-P, ELISA. It is affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific immunogenand is unconjugated. The antibody is produced in rabbit by using as an immunogen synthesized peptide derived from the C-terminal region of human Dkk-1
Dkk-1 Polyclonal Antibody
ABP53293-02ml 0.2ml
EUR 414
  • Immunogen information: Synthesized peptide derived from the C-terminal region of human Dkk-1
  • Applications tips:
Description: A polyclonal antibody for detection of Dkk-1 from Human, Mouse, Rat. This Dkk-1 antibody is for WB, IHC-P, ELISA. It is affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific immunogenand is unconjugated. The antibody is produced in rabbit by using as an immunogen synthesized peptide derived from the C-terminal region of human Dkk-1
Dkk-1 Polyclonal Antibody
41928-100ul 100ul
EUR 252
Dkk-1 Polyclonal Antibody
41928-50ul 50ul
EUR 187
Anti-Dkk-1 antibody
STJ97257 200 µl
EUR 197
Description: Rabbit polyclonal to Dkk-1.
Anti-Dkk-1 antibody
STJ98000 100 µl
EUR 234
Description: Mouse monoclonal to Dkk-1.
Human CellExp? DKK-1, Human Recombinant
EUR 278
Human CellExp? DKK-1, Human Recombinant
EUR 1132
GT15222 100 ug
EUR 526
ELISA kit for Human DKK-1
EK5390 96 tests
EUR 553
Description: Enzyme-linked immunosorbent assay kit for quantification of Human DKK-1 in samples from serum, plasma, tissue homogenates and other biological fluids.
Human DKK-1 PicoKine ELISA Kit
EK0867 96 wells
EUR 425
Description: For quantitative detection of human DKK1 in cell culture supernates, cell lysates, serum and plasma (heparin, EDTA).
Dkk-1 Polyclonal Conjugated Antibody
C41928 100ul
EUR 397
DKK-1 (CHO-expressed), Mouse
HY-P7154 50ug
EUR 762
Recombinant Mouse Dkk-1 Protein
RP01062 5 μg
EUR 183
Human DKK-1 ELISA kit (4×96T)
LF-EK50798 4×96T
EUR 2201
Dkk-3 antibody
22898-100ul 100ul
EUR 390
EF000091 96 Tests
EUR 689
Recombinant Human Dkk-3 Protein
RP00355 10 μg
EUR 164
ELISA kit for Rat DKK-1
EK5668 96 tests
EUR 553
Description: Enzyme-linked immunosorbent assay kit for quantification of Rat DKK-1 in samples from serum, plasma, tissue homogenates and other biological fluids.
Human DKK-1(Dickkopf-related protein 1) ELISA Kit
EH0113 96T
EUR 524.1
  • Detection range: 31.25-2000 pg/ml
  • Uniprot ID: O94907
  • Alias: DKK1/dickkopf(Xenopus laevis) homolog 1/dickkopf homolog 1(Xenopus laevis)/dickkopf related protein-1/Dickkopf-1/dickkopf-related protein 1/Dkk-1/DKK-1/SKdickkopf-1 like
Description: Method of detection: Double Antibody, Sandwich ELISA;Reacts with: Homo sapiens;Sensitivity: 18.75pg/ml
Dkk-1 ELISA Kit (Human) : 96 Wells (OKAG00221)
OKAG00221 96 Wells
EUR 596
Description: Description of target: This gene encodes a protein that is a member of the dickkopf family. It is a secreted protein with two cysteine rich regions and is involved in embryonic development through its inhibition of the WNT signaling pathway. Elevated levels of DKK1 in bone marrow plasma and peripheral blood is associated with the presence of osteolytic bone lesions in patients with multiple myeloma.;Species reactivity: Human;Application: ELISA;Assay info: Quantitative Colorimentric Sandwich ELISA;Sensitivity: 63 pg/mL
Dkk-3 Polyclonal Antibody
ES5541-100ul 100ul
EUR 279
Description: A Rabbit Polyclonal antibody against Dkk-3 from Human/Mouse. This antibody is tested and validated for WB, ELISA, WB, ELISA
Dkk-3 Polyclonal Antibody
ES5541-50ul 50ul
EUR 207
Description: A Rabbit Polyclonal antibody against Dkk-3 from Human/Mouse. This antibody is tested and validated for WB, ELISA, WB, ELISA
Dkk-3 Polyclonal Antibody
ABP54542-003ml 0.03ml
EUR 158
  • Immunogen information: Synthesized peptide derived from the Internal region of human Dkk-3 at AA rangle: 80-160
  • Applications tips:
Description: A polyclonal antibody for detection of Dkk-3 from Human, Mouse. This Dkk-3 antibody is for WB, ELISA. It is affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific immunogenand is unconjugated. The antibody is produced in rabbit by using as an immunogen synthesized peptide derived from the Internal region of human Dkk-3 at AA rangle: 80-160
Dkk-3 Polyclonal Antibody
ABP54542-01ml 0.1ml
EUR 289
  • Immunogen information: Synthesized peptide derived from the Internal region of human Dkk-3 at AA rangle: 80-160
  • Applications tips:
Description: A polyclonal antibody for detection of Dkk-3 from Human, Mouse. This Dkk-3 antibody is for WB, ELISA. It is affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific immunogenand is unconjugated. The antibody is produced in rabbit by using as an immunogen synthesized peptide derived from the Internal region of human Dkk-3 at AA rangle: 80-160
Dkk-3 Polyclonal Antibody
ABP54542-02ml 0.2ml
EUR 414
  • Immunogen information: Synthesized peptide derived from the Internal region of human Dkk-3 at AA rangle: 80-160
  • Applications tips:
Description: A polyclonal antibody for detection of Dkk-3 from Human, Mouse. This Dkk-3 antibody is for WB, ELISA. It is affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific immunogenand is unconjugated. The antibody is produced in rabbit by using as an immunogen synthesized peptide derived from the Internal region of human Dkk-3 at AA rangle: 80-160
Anti-Dkk-3 antibody
STJ92720 200 µl
EUR 197
Description: Rabbit polyclonal to Dkk-3.
Anti-Dkk-3 antibody
STJ98001 100 µl
EUR 234
Description: Mouse monoclonal to Dkk-3.
Human DKK-4 PicoKine ELISA Kit
EK0868 96 wells
EUR 455
Description: For Quantitative Detection of human DKK-4 in cell culture supernates, serum and plasma(heparin, EDTA).
Human DKK-3 PicoKine ELISA Kit
EK1323 96 wells
EUR 425
Description: For quantitative detection of human DKK-3 in cell culture supernates, cell lysates, serum and plasma (heparin, EDTA).
Recombinant Human Dkk-3/DKK3 Protein
RP00209 10 μg
EUR 155
DKK-3 ELISA Kit (Human) (OKBB00603)
OKBB00603 96 Wells
EUR 505
Description: Description of target: Dickkopf-related protein 3 is a protein that in humans is encoded by the DKK3 gene. This gene encodes a protein that is a member of the dickkopf family. It is mapped to 11p15.3. The secreted protein contains two cysteine rich regions and is involved in embryonic development through its interactions with the Wnt signaling pathway. The expression of this gene is decreased in a variety of cancer cell lines and it may function as a tumor suppressor gene. Members of the Dkk-related family display unique patterns of mRNA expression in human and mouse tissues, and are secreted when expressed in 293T cells. DKKs play an important role in vertebrate development, where they locally inhibit Wnt regulated processes such as antero-posterior axial patterning, limb development, somitogenesis and eye formation. In the adult, Dkks are implicated in bone formation and bone disease, cancer and Alzheimer disease.;Species reactivity: Human;Application: ELISA;Assay info: Assay Methodology: Quantitative Sandwich Immunoassay;Sensitivity: <= 10 pg/mL
Recombinant Dkk-1 Protein (Thr 32-His 266) [Fc]
VAng-1451Lsx-100g 100 µg
EUR 848
Description: Human Dkk-1, Fc tag, is expressed in HEK 293 cells. (Uniprot ID: NP_036374.1)
Recombinant Dkk-1 Protein (Thr 32-His 266) [Fc]
VAng-1451Lsx-1mg 1 mg
EUR 4724
Description: Human Dkk-1, Fc tag, is expressed in HEK 293 cells. (Uniprot ID: NP_036374.1)
Recombinant Dkk-1 Protein (Thr 32-His 266) [His]
VAng-1453Lsx-100g 100 µg
EUR 1013
Description: Human Dkk-1, His tag, is expressed in HEK 293 cells. (Uniprot ID: NP_036374.1)
Recombinant Dkk-1 Protein (Thr 32-His 266) [His]
VAng-1453Lsx-1mg 1 mg
EUR 4999
Description: Human Dkk-1, His tag, is expressed in HEK 293 cells. (Uniprot ID: NP_036374.1)
Recombinant Dkk-1 Protein (Thr 32-His 266) [Strep]
VAng-1454Lsx-1mg 1 mg
EUR 6374
Description: Human Dkk-1, Fc tag, is expressed in HEK 293 cells. (Uniprot ID: NP_036374.1)
Recombinant Dkk-1 Protein (Thr 32-His 266) [Strep]
VAng-1454Lsx-250g 250 µg
EUR 2470
Description: Human Dkk-1, Fc tag, is expressed in HEK 293 cells. (Uniprot ID: NP_036374.1)
Recombinant Dkk-1 Protein (Thr 32-His 266) [Strep]
VAng-1454Lsx-25g 25 µg
EUR 765
Description: Human Dkk-1, Fc tag, is expressed in HEK 293 cells. (Uniprot ID: NP_036374.1)
Recombinant Dkk-1 Protein (Thr 32-His 272) [His]
VAng-1455Lsx-500g 500 µg
EUR 4449
Description: Mouse Dkk-1, His tag, is expressed in HEK 293 cells. (Uniprot ID: O54908)
Recombinant Dkk-1 Protein (Thr 32-His 272) [His]
VAng-1455Lsx-50g 50 µg
EUR 1013
Description: Mouse Dkk-1, His tag, is expressed in HEK 293 cells. (Uniprot ID: O54908)
Recombinant Dkk-1 Protein (Thr 32-His 266) [Fc] [Avi]
VAng-1452Lsx-200g 200 µg
EUR 3844
Description: Biotinylated Human Dkk-1, Fc tag and Avi tag, is expressed in HEK 293 cells. (Uniprot ID: O94907-1)
Recombinant Dkk-1 Protein (Thr 32-His 266) [Fc] [Avi]
VAng-1452Lsx-25g 25 µg
EUR 1013
Description: Biotinylated Human Dkk-1, Fc tag and Avi tag, is expressed in HEK 293 cells. (Uniprot ID: O94907-1)
Human DKK-3(Dickkopf-related protein 3) ELISA Kit
EH0114 96T
EUR 567.6
  • Detection range: 62.5-4000 pg/ml
  • Uniprot ID: Q9UBP4
  • Alias: DKK-3/Dickkopf-3/Dkk3/REIC
Description: Method of detection: Double Antibody, Sandwich ELISA;Reacts with: Homo sapiens;Sensitivity: 37.5pg/ml
Recombinant Dkk-3 Protein (Pro 23-Ile 349) [His]
VAng-1456Lsx-1mg 1 mg
EUR 5494
Description: Mouse Dkk-3, His tag, is expressed in HEK 293 cells. (Uniprot ID: NP_056629.1)
Recombinant Dkk-3 Protein (Pro 23-Ile 349) [His]
VAng-1456Lsx-50g 50 µg
EUR 848
Description: Mouse Dkk-3, His tag, is expressed in HEK 293 cells. (Uniprot ID: NP_056629.1)
Recombinant Dkk-3 Protein (Pro 23-Ile 350) [His]
VAng-1457Lsx-200g 200 µg
EUR 1123
Description: Human Dkk-3, His tag, is expressed in HEK 293 cells. (Uniprot ID: NP_001018067.1)
Recombinant Dkk-3 Protein (Pro 23-Ile 350) [His]
VAng-1457Lsx-20g 20 µg
EUR 380
Description: Human Dkk-3, His tag, is expressed in HEK 293 cells. (Uniprot ID: NP_001018067.1)
Hemokinin 1 (human)
B5318-1 1 mg
EUR 340
Endothelin-1 (1-15), amide, human
A1111-1 1 mg
EUR 722
Description: Endothelins are 21-amino acid vasoconstricting peptides produced primarily in the endothelium and have a key role in vascular homeostasis.
Haptoglobin, (Phenotype 1-1) Human Plasma
EUR 321
Recombinant Human Dickkopf-Related Protein 2/DKK-2 (N-Fc, C-6His)
CC49-10ug 10ug
EUR 156
Description: Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl,pH7.2.
Recombinant Human Dickkopf-Related Protein 2/DKK-2 (N-Fc, C-6His)
CC49-1mg 1mg
EUR 2283
Description: Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl,pH7.2.
Recombinant Human Dickkopf-Related Protein 2/DKK-2 (N-Fc, C-6His)
CC49-500ug 500ug
EUR 1613
Description: Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl,pH7.2.
Recombinant Human Dickkopf-Related Protein 2/DKK-2 (N-Fc, C-6His)
CC49-50ug 50ug
EUR 369
Description: Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl,pH7.2.
BNP (1-32), human
A1105-1 1 mg
EUR 177
Description: Basic natriuretic peptide (BNP), now known as B-type natriuretic peptide (also BNP) or GC-B, is a 32 amino acid polypeptide secreted by the ventricles of the heart in response to excessive stretching of heart muscle cells (cardiomyocytes).
IGF-1, human recombinant
P1016-.1 100 µg
EUR 763
Description: Insulin-like growth factor I (IGF-1) is a polypeptide endocrine hormone structurally similar to insulin and is mainly produced in the liver when stimulated by growth hormone. IGF-1 is a growth factor that stimulates the proliferation of various cell types including muscle, bone, and cartilage tissue
Neuregulin/Heregulin-1? (NRG-1?/HRG-1?), human recombinant protein
P1054-1 1 mg
EUR 3947
Description: Neuregulin (NRG) is a signaling protein for ErbB2/ErbB4 receptor heterodimers on the cardiac muscle cells and plays an important role in heart structure and function through inducing cardiomyocyte differentiation
IL1RL1 Human, Interleukin-1 Receptor Like-1 Human Recombinant Protein, Sf9
PROTQ01638-1 Regular: 10ug
EUR 317
Description: IL 1RL1 produced in Sf9 Baculovirus cells is a single, glycosylated polypeptide chain (19-328 a.a.) and fused to an 8 aa His Tag at C-terminus containing a total of 318 amino acids and having a molecular mass of 36.0kDa.;IL 1RL1 shows multiple bands between 40-57kDa on SDS-PAGE, reducing conditions and purified by proprietary chromatographic techniques.
MMP-1 Matrix Metalloproteinase-1 Human Recombinant Protein
PROTP03956-1 Regular: 20ug
EUR 317
Description: MMP 1 Human Recombinant produced in E.coli is a single, non-glycosylated polypeptide chain containing 393 amino acids (100-469a.a) and having a molecular mass of 45kDa. MMP 1 is fused to a 23 amino acid His-tag at N-terminus.
PSG1 Human, Pregnancy Specific Beta-1-Glycoprotein 1 Human Recombinant Protein, Sf9
PROTP11464-1 Regular: 10ug
EUR 317
Description: PSG1 Human Recombinant produced in Sf9 Baculovirus cells is a single, glycosylated polypeptide chain containing 394 amino acids (35-419a.a.) and having a molecular mass of 44.6kDa (Molecular size on SDS-PAGE will appear at approximately 40-57kDa). PSG1 is expressed with a 6 amino acids His tag at C-Terminus and purified by proprietary chromatographic techniques.
Amyloid ?-Peptide (1-42) (human)
B6057-.1 100 ug
EUR 276
Parathyroid hormone (1-34) (human)
A1129-1 1 mg
EUR 166
Description: Parathyroid hormone (1-34) (human), (C181H291N55O51S2), a peptide with the sequence H2N-SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF-OH, MW= 4117.72.
ApoA-1, human recombinant protein
P1052-.1 100 µg
EUR 313
Description: Apolipoprotein A-1 (ApoA-1) is a glycoprotein produced in the liver and intestine that is the major protein component of high density lipoprotein (HDL) particles. ApoA-1 is involved in the reverse transport of cholesterol from peripheral tissues to the liver for recycling and excretion.
ApoA-1, human recombinant protein
P1052-1 1 mg
EUR 1553
Description: Apolipoprotein A-1 (ApoA-1) is a glycoprotein produced in the liver and intestine that is the major protein component of high density lipoprotein (HDL) particles. ApoA-1 is involved in the reverse transport of cholesterol from peripheral tissues to the liver for recycling and excretion.
WNT-1, human recombinant protein
P1068-1 1 mg
EUR 6940
Description: The WNT gene family compose of structurally related genes that encode secreted signaling proteins. These proteins have been involved in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryogenesis.
Recombinant Human Gremlin-1 Protein
PROTO60565-1 50ug
EUR 317
Description: Gremlin-1 (isoform-1) belongs to a group of diffusible proteins which bind to ligands of the TGF-β family and regulate their activity by inhibiting their access to signaling receptors. The interplay between TGF-β ligands and their natural antagonists has major biological significance during development processes, in which cellular response can vary considerably depending upon the local concentration of the signaling molecule. Gremlin is highly expressed in the small intestine, fetal brain, and colon and lower expression in brain, prostate, pancreas and skeletal muscle.  Gremlin-1 regulates multiple functions in early development by specifically binding to and inhibiting the function of BMP-2, -4, and -7.  It also plays a role in carcinogenesis and kidney branching morphogenesis. Recombinant Gremlin-1 is a 18.3  kDa protein containing 160 amino acid residues.
ORM1 Orosomucoid 1 Human protein
PROTP02763-1 Regular: 10ug
EUR 317
Description: The Human Orosomucoid 1 produced from Human pooled serum has a molecular mass of 21.56kDa (calculated without glycosylation) containing 183 amino acid residues.
Recombinant Human Galectin-1 Protein
PROTP09382-1 50ug
EUR 317
Description: Lectins, of either plant or animal origin, are carbohydrate binding proteins that interact with glycoprotein and glycolipids on the surface of animal cells. The Galectins are lectins that recognize and interact with β-galactoside moieties. Galectin-1 is an animal lectin that has been shown to interact with CD3, CD4, and CD45. It induces apoptosis of activated T-cells and T-leukemia cell lines and inhibits the protein phosphatase activity of CD45. Recombinant human Galectin-1 is a 14.5 kDa protein containing 134 amino acid residues.
Recombinant Human PECAM-1 Protein
PROTP16284-1 50ug
EUR 317
Description: PECAM is transmembrane glycoprotein that belongs to the Ig-related superfamily of adhesion molecules. It is highly expressed at endothelial cell junctions, and also expressed in platelets and in most leukocyte sub-types. The primary function of PECAM-1 is the mediation of leukocyte-endothelial cell adhesion and signal transduction. PECAM-1 has been implicated in the pathogenesis of various inflammation related disorders, including thrombosis, multiple sclerosis (MS), and rheumatoid arthritis. The human PECAM-1 gene codes for a 738 amino acid transmembrane glycoprotein containing a 118 amino acid cytoplasmic domain, a 19 amino acid transmembrane domain, and a 574 amino acid extracellular domain. Recombinant human PECAM-1 is a 572 amino acid glycoprotein comprising the extracellular domain of PECAM-1. Monomeric glycosylated PECAM-1 migrates at an apparent molecular weight of approximately 80.0-95.0 kDa by SDS-PAGE analysis under reducing conditions
Recombinant Human ANG-1 Protein
PROTQ15389-1 20ug
EUR 317
Description: Angiopoietin-1 (Ang-1) is a secreted ligand for Tie-2, a tyrosine-kinase receptor expressed primarily on vascular endothelial cells and early hematopoietic cells. Ang-1/ Tie-2 signaling promotes angiogenesis during the development, remodeling, and repair of the vascular system. Transgenic mice lacking expression of either Ang-1 or Tie-2 fail to develop a fully functional cardiovascular system and die before birth. Postnatally, the angiogenic activity of Ang-1/Tie-2 is required during normal tissue repair and remodeling of the female endometrium in the menstrual cycle. Ang-1/Tie-2 signaling appears to be regulated by Angiopoietin-2 (Ang-2), a natural antagonist for Tie-2 that exerts its effects through an internal autocrine loop mechanism. In addition to suppressing endothelial cell activation by inhibiting the expression of adhesion and inflammatory molecules, Ang-1 enhances endothelial cell survival and capillary morphogenesis, and lessens capillary permeability. As such, Ang-1 has a potential to become an effective therapeutic agent for treating various endothelium disorders, including several severe human pulmonary diseases. The efficacy of cell-based Ang-1 gene therapy for acute lung injury (ALI) has recently been studied in a rat model of ALI (1). The results of this study show that such therapy can markedly improve lung condition and suggest that Ang-1 therapy may represent a potential new strategy for the treatment and/or prevention of acute respiratory distress injury (ARDI), a significant cause of morbidity and mortality in critically ill patients. Recombinant human ANG-1, derived from HeLa cells, is a C-terminal histidine tagged glycoprotein which migrates with an apparent molecular mass of 60.0 – 70.0 kDa by SDS-PAGE under reducing conditions. Sequencing analysis shows N-terminal sequences starting with Ser-20 and with Asp-70 of the 498 amino acid precursor protein.
(1-328) RAD51D (1-328 a.a.) Human Recombinant Protein
PROTO75771-1 Regular: 10ug
EUR 317
Description: RAD51D (1-328) Human Recombinant produced in E. coli is. a single polypeptide chain containing 351 amino acids and having a molecular mass of 37.4kDa. RAD51D (1-328) is fused to a 23 amino acid His-tag at N-terminus & purified by proprietary chromatographic techniques.
NXPH1 Human, Neurexophilin 1 Human Recombinant Protein, Sf9
PROTP58417-1 Regular: 10ug
EUR 317
Description: NXPH1 Human Recombinant produced in Sf9 Baculovirus cells is a single, glycosylated polypeptide chain containing 259 amino acids (22-271) and having a molecular mass of 29.7kDa (Molecular size on SDS-PAGE will appear at approximately 28-40kDa).;NXPH1 is fused to 9 amino acid His-Tag at C-terminus and purified by proprietary chromatographic techniques.
Human KRAB-associated Protein 1 (KAP-1) AssayMax ELISA Kit
EK2802-1 96 Well Plate
EUR 477
Human Interleukin-1 beta (IL-1 beta) AssayMax ELISA Kit
EI2200-1 96 Well Plate
EUR 477
Human Interleukin-1-alpha (IL-1-alpha) AssayMax ELISA Kit
EI2301-1 96 Well Plate
EUR 477
Human Plasminogen Activator Inhibitor-1 (PAI-1) AssayMax ELISA Kit
EP1100-1 96 Well Plate
EUR 417
TGF-b-1 Transforming Growth Factor-beta 1 Human protein
PROTP01137-1 Regular: 2.5ug
EUR 1157
Description: Human Transforming Growth Factor-beta 1 purified from Human Platelets having a molecular mass of 25kDa.;The TGF-b 1 is purified by proprietary chromatographic techniques.
MCP-1 Monocyte Chemotactic Protein-1 Human Recombinant Protein (CCL2)
PROTP13500-1 Regular: 20ug
EUR 317
Description: Monocyte Chemotactic Protein-1 Human Recombinant also known as Monocyte Chemotactic and Activating Factor (MCAF) produced in E.Coli is a non-glycosylated, Polypeptide chain containing 76 amino acids and having a molecular mass of 8.6kDa. ;The MCP-1 is purified by proprietary chromatographic techniques.
GAD1 iso1 Glutamate Decarboxylase 1 Isoform-1 Human Recombinant Protein
PROTQ99259-1 Regular: 20ug
EUR 317
Description: GAD1 iso1 Human Recombinant produced in E.Coli is a single, non-glycosylated polypeptide chain containing 617 amino acids (1-594 a.a) and having a molecular mass of 69.3kDa. GAD1 iso1 is fused to a 23 amino acid His-tag at N-terminus & purified by proprietary chromatographic techniques.
Brain natriuretic peptide (1-32) (human)
B5442-1 1 mg
EUR 518
Human Glutaredoxin-1 AssayMax ELISA Kit
EG2153-1 96 Well Plate
EUR 417
Human Complexin-1 AssayMax ELISA Kit
EC3505-1 96 Well Plate
EUR 417
Human Hexokinase-1 AssayMax ELISA Kit
EH3101-1 96 Well Plate
EUR 477
Ac-Endothelin-1 (16-21), human
A1016-1 1 mg
EUR 84
Description: ENDOTHELIN-1 (ET-1), the principal peptide of the endothelin family, has been shown to have a variety of biological activities in both vascular and nonvascular tissues, including the heart, the kidney, and the central nervous system.
Amyloid Beta-Peptide (1-40) (human)
A1124-1 1 mg
EUR 189
Description: Amyloid ?-Peptide (1-40) (human), (C194H295N53O58S1), a peptide with the sequence H2N-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA-OH, MW= 4329.8. Amyloid beta (A? or Abeta) is a peptide of 36-43 amino acids that is processed from the Amyloid precursor protein.
IFN-alpha 1, human recombinant protein
P1058-.1 100 µg
EUR 313
Description: IFN-?1 (also called IFN-?) is a lymphoid factor with potent antiviral antiproliferative and immunomodulatory properties. Human IFN-?1 is a 19.3 kDa protein containing 166 amino acid residues.
IFN-alpha 1, human recombinant protein
P1058-1 1 mg
EUR 2277
Description: IFN-?1 (also called IFN-?) is a lymphoid factor with potent antiviral antiproliferative and immunomodulatory properties. Human IFN-?1 is a 19.3 kDa protein containing 166 amino acid residues.
OryzaExp? IGF-1 LR3, Human Recombinant
EUR 881
Recombinant Human sTRAIL Receptor-1 Protein
PROTO00220-1 50ug
EUR 317
Description: TRAIL Receptor-1/DR4 and TRAIL Receptor-2/DR5 belong to the TNFR superfamily of transmembrane proteins and contain a cytoplasmic "death domain, " which can activate the cell's apoptotic machinery. These receptors are activated by binding to either membrane anchored or soluble TRAIL/Apo2L. Recombinant human soluble TRAIL Receptor-1/DR4 is a 22.7 kDa protein (215 amino acid residues) consisting of the TNFR homologous, cysteine rich portion of the extracellular domain.
Recombinant Human LAG-1 (CCL4L1) Protein
PROTP13236-1 20ug
EUR 317
Description: LAG-1 is CC chemokine that signals through the CCR5 receptor. LAG-1 is identical to MIP-1β (ACT II isotype) except for two amino acid substitutions; arginine for histidine at position 22 and serine for glycine at position 47 of the mature protein. LAG-1 chemoattracts monocytes, and exhibits activity as an HIV suppressive factor. Recombinant human LAG-1 is a 7.7 kDa protein containing 69 amino acid residues.
NNT1 Neurotrophin-1 Human Recombinant Protein
PROTQ9UBD9-1 Regular: 10ug
EUR 317
Description: Neurotrophin-1 Human Recombinant (28-225) produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 199 amino acids and having a molecular mass of 22kDa.;The NNT-1 is purified by proprietary chromatographic techniques.
HPSE Heparanase-1 Human Recombinant Protein
PROTQ9Y251-1 Regular: 20ug
EUR 317
Description: HPSE Human Recombinant produced in E.Coli is a single, non-glycosylated polypeptide chain containing 531 amino acids (36-543 a.a) and having a molecular mass of 60kDa.;HPSE is fused to a 23 amino acid His-tag at N-terminus.
SDC1 Syndecan-1 Human Recombinant Protein
PROTP18827-1 Regular: 20ug
EUR 317
Description: SDC1 Human Recombinant produced in E. coli is a single polypeptide chain containing 262 amino acids (18-254) and having a molecular mass of 27kDa (molecular size on SDS-PAGE will appear higher).;SDC1 is fused to a 25 amino acid His-tag at N-terminus & purified by proprietary chromatographic techniques.
Recombinant Human Heregulin Beta -1 Protein
PROTQ02297-1 50ug
EUR 317
Description: Neuregulin/Heregulin is a family of structurally related polypeptide growth factors derived from alternatively spliced genes (NRG1, NRG2, NRG3 and NRG4). To date, there are over 14 soluble and transmembrane proteins derived from the NRG1 gene. Proteolytic processing of the extracellular domain of the transmembrane NRG1 isoforms release soluble growth factors. HRG1-β1 contains an Ig domain and an EGF-like domain that is necessary for direct binding to receptor tyrosine kinases erb3 and erb4. This binding induces erb3 and erb4 heterodimerization with erb2, stimulating intrinsic kinase activity, which leads to tyrosine phosphorylation. Although HRG1-β1 biological effects is still unclear, it has been found to promote motility and invasiveness of breast cancer cells which may also involve up-regulation of expression and function of the autocrine motility-promoting factor (AMF). Recombinant human Heregulin-β1 (HRG1-β1) is a 7.5 kDa polypeptide consisting of only the EGF domain of Heregulin-β1 (65 amino acid residues).
CTF1 Cardiotrophin-1 Human Recombinant Protein
PROTQ16619-1 Regular: 10ug
EUR 317
Description: Cardiotrophin-1 Human Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 201 amino acids and having a molecular mass of 21.2kDa.;The CTF1 is purified by proprietary chromatographic techniques.
TPST1 Human, Tyrosylprotein Sulfotransferase 1, sf9 Human Recombinant Protein
PROTO60507-1 Regular: 5ug
EUR 317
Description: TPST1 produced in Sf9 Baculovirus cells is a single, glycosylated polypeptide chain containing 354 amino acids (26-370 a.a.) and having a molecular mass of 40.6kDa (Migrates at 40-57kDa on SDS-PAGE under reducing conditions). 
ITGB1 Human, Integrin Beta 1 Human Recombinant Protein, Sf9
PROTP05556-1 Regular: 10ug
EUR 317
Description: ITGB1 Human Recombinant produced in Sf9 Baculovirus cells is a single, glycosylated polypeptide chain containing 716 amino acids (1-728) and having a molecular mass of 79.4kDa (Molecular size on SDS-PAGE will appear at approximately 70-100kDa). ITGB1 is fused to an 8 amino acid His-Tag at C-terminus and purified by proprietary chromatographic techniques. 
KLK1 Human, Kallikrein-1 Human Recombinant Protein, His Tag
PROTP06870-1 Regular: 10ug
EUR 317
Description: Kallikrein-1 Human Recombinant produced in E.coli is a single, non-glycosylated polypeptide chain containing 259 amino acids (25-262) and having a molecular mass of 28.7kDa.;KLK1 is fused to a 23 amino acid His-tag at N-terminus & purified by proprietary chromatographic techniques.
NRN1 Human, Neuritin-1 Human Recombinant Protein, His Tag
PROTQ9NPD7-1 Regular: 10ug
EUR 317
Description: Neuritin-1 Human Recombinant produced in E.Coli is a single, non-glycosylated, polypeptide chain (Ala28-Gly116) containing 99 amino acids including a 10 aa His tag at N-terminus. The total calculated molecular mass is 11.02kDa.
PHPT1 Human, Phosphohistidine Phosphatase 1 Human Recombinant Protein, Active
PROTQ9NRX4-1 Regular: 10ug
EUR 317
Description: PHPT1 produced in E.Coli is a single, non-glycosylated polypeptide chain containing 145 amino acids (1-125a.a.) and having a molecular mass of 15.9kDa.;PHPT1 is fused to a 20 amino acid His-tag at N-terminus & purified by proprietary chromatographic techniques.
FOLR1 Human, Folate Receptor 1 Human Recombinant Protein, sf9
PROTP15328-1 Regular: 5ug
EUR 317
Description: FOLR1 Human Recombinant produced in Sf9 Baculovirus cells is a single, glycosylated polypeptide chain containing 218 amino acids (26-234a.a.) and having a molecular mass of 25.6kDa (Molecular size on SDS-PAGE will appear at approximately 28-40kDa).;FOLR1 is expressed with a 6 amino acid His tag at C-Terminus and purified by proprietary chromatographic techniques.
PGAM1 Human, Phosphoglycerate Mutase 1 Human Recombinant Protein, Active
PROTP18669-1 Regular: 10ug
EUR 317
Description: PGAM1 Human Recombinant produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 274 amino acids (1-254 a.a.) and having a molecular mass of 30.9 kDa. The PGAM1 is fused to a 20 amino acid His Tag at N-Terminus and purified by proprietary chromatographic techniques.
TPI1 Human, Triosephosphate Isomerase 1 Human Recombinant Protein, Active
PROTP60174-1 Regular: 10ug
EUR 317
Description: TPI1 produced in E.Coli is a single, non-glycosylated polypeptide chain containing 269 amino acids (1-249a.a.) and having a molecular mass of 28.8kDa.;TPI1 is fused to a 20 amino acid His-tag at N-terminus & purified by proprietary chromatographic techniques.
DLK1 Human, Delta-Like 1 Human Recombinant Protein, HEK
PROTP80370-1 Regular: 10ug
EUR 317
Description: DLK1 Human Recombinant produced in HEK293 Cells is a single, glycosylated, polypeptide chain (a.a 24-303) containing 290 amino acids including a 10 a.a C-terminal His tag. The total molecular mass is 31.2kDa (calculated). 
FSTL1 Human, Follistatin Like 1 Human Recombinant Protein, HEK
PROTQ12841-1 Regular: 10ug
EUR 317
Description: FSTL1 Human Recombinant produced in HEK293 cells is a single, glycosylated polypeptide chain (a.a 21-308) containing 296 amino acids including a 8 a.a C-terminal His tag. The total molecular mass is 33.8kDa (calculated).
GUK1 Human, Guanylate Kinase 1 Human Recombinant Protein, Active
PROTQ16774-1 Regular: 10ug
EUR 317
Description: GUK1 Human Recombinant produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 217 amino acids (1-197 a.a.)and having a total molecular mass of 23.9 kDa. ;GUK1 is fused to a 20 amino acid His Tag at N-terminus and is purified by proprietary chromatographic techniques.
Human, LAG-1 (CCL4L1) Human Recombinant Protein, His Tag
PROTQ8NHW4-1 Regular: 20ug
EUR 317
Description: LAG-1 Human Recombinant produced in E.Coli is a single, non-glycosylated polypeptide chain containing 94 amino acids (24-92 a.a.) and having a molecular mass of 10.5kDa (Molecular weight on SDS-PAGE will appear higher).;LAG-1 is fused to a 25 amino acid His-tag at N-terminus & purified by proprietary chromatographic techniques.
Human Insulin-like Growth Factor 1 (IGF-1) AssayMax ELISA Kit
EI1001-1 96 Well Plate
EUR 477
Human Heat Shock Factor Protein 1 (HSF 1) AssayMax ELISA kit
EH5215-1 96 Well Plate
EUR 417
GLP-1 Glucagon Like Peptide-1 (31 a.a.) Human Recombinant Protein
PROTP01275-1 Regular: 50ug
EUR 317
Description: Glucagon Like Peptide-1 Human Recombinant produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 31 amino acids and having a molecular mass of 3298.7 Dalton. The GLP-1 is purified by proprietary chromatographic techniques.
IL-1-alpha Interleukin-1 alpha Human Recombinant Protein, His Tag
PROTP01583-1 Regular: 20ug
EUR 317
Description: IL-1A Human Recombinant produced in E.Coli is single, a non-glycosylated, Polypeptide chain containing 159 amino acids fragment (113-271) with an amino-terminal hexahistidine tag and having a total molecular mass of 22.5kDa. ;The Interleukin-1 alpha His-tag is purified by proprietary chromatographic techniques.
VAMP2 (1-94) Synaptobrevin-2 (1-94 a.a) Human Recombinant Protein
PROTP63027-1 Regular: 5ug
EUR 317
Description: VAMP2 Human Recombinant produced in E.Coli is a single, non-glycosylated polypeptide chain containing 118 amino acids (1-94 a.a) and having a molecular mass of 12.8kDa.;VAMP2 is fused to a 24 amino acid His-tag at N-terminus & purified by proprietary chromatographic techniques.
DCTN2 (1-406) Dynactin 2 (1-406 a.a.) Human Recombinant Protein
PROTQ13561-1 Regular: 20ug
EUR 317
Description: Dynactin 2 Human Recombinant produced in E.Coli is a single, non-glycosylated polypeptide chain containing 429 amino acids (1-406 a.a) and having a molecular mass of 47.2kDa.;DCTN2 is fused to a 23 amino acid His-tag at N-terminus & purified by proprietary chromatographic techniques.

Synthetic Biosystem for Modulation of Interactions between Antigen-Presenting Cells and T Cells

T cell activation is triggered by sign molecules on the floor of antigen-presenting cells (APC) and subsequent exertion of mobile forces. Deciphering the biomechanical and biochemical indicators on this advanced course of is of curiosity and can contribute to an enchancment in immunotherapy methods.

To handle underlying questions, coculture and biomimetic fashions are established. Mature dendritic cells (mDC) are first handled with cytochalasin B (CytoB), a cytoskeletal disruption agent identified to decrease obvious mobile stiffness and discount in T cell proliferation is noticed.

It’s tried to imitate mDC and T cell interactions utilizing polyacrylamide (PA) gels with outlined stiffness akin to mDC (0.2-25 kPa). Completely different ratios of anti-CD3 (aCD3) and anti-CD28 (aCD28) antibodies are immobilized onto PA gels.

The outcomes present T cell proliferation is triggered by each aCD3 and aCD28 in a stiffness-dependent method. Cells cultured on aCD3 immobilized on gels has considerably enhanced proliferation and IL-2 secretion, in comparison with aCD28. Moreover, ZAP70 phosphorylation is enhanced in stiffer substrate a in a aCD3-dependent method.

The biosystem supplies an strategy to review the discount of T cell proliferation noticed on CytoB-treated mDC. Total, the biosystem permits distinguishing the affect of biophysical and biochemical indicators of APC and T cell interactions in vitro.

Graphene-based nanomaterials in biosystems.

Graphene-based nanomaterials have emerged as a novel sort of supplies with distinctive physicochemical properties and quite a few functions in varied areas. On this overview, we summarize latest advances in finding out interactions between graphene and biosystems.

We first present a short introduction on graphene and its derivatives, after which focus on on the toxicology and biocompatibility of graphene, together with the extracellular interactions between graphene and biomacromolecules, mobile research of graphene, and in vivo toxicological results.

Subsequent, we concentrate on varied graphene-based sensible functions in antibacterial supplies, wound addressing, drug supply, and water purification. We lastly current views on challenges and future developments in these thrilling fields.

Preface: Management and Design of Biosystems.

Biosystems are dynamic networks pushed by cross-scale interactions between molecules, cells, tissues, organs and organisms. Latest advances in our understanding of the spatiotemporal regulation and group of biosystems have stimulated exploration of novel approaches to regulate and design biosystems at a number of organic scales.

Such new approaches embrace synthetic cell synthesis, technology of embryoids/organoids, reconstitution and manipulation of life occasions corresponding to getting old and replica, and multidisciplinary approaches utilizing theoretical and engineering applied sciences. These control-and-design methodologies are anticipated to open up a new avenue to understanding life occasions in addition to to supply the idea for novel design methods in medical sciences.

Rabbit Polyclonal antibody Anti-CRBN

Anti-CRBN 50 µg
EUR 349


ELI-21303h 96 Tests
EUR 824

Human KIR2DL4 shRNA Plasmid

  • EUR 801.00
  • EUR 1121.00
  • 150 µg
  • 300 µg
  • Shipped within 15-20 working days.

KIR2DL4 Recombinant Protein (Human)

RP017041 100 ug Ask for price

KIR2DL4 Polyclonal Antibody

27806-100ul 100ul
EUR 252

KIR2DL4 Polyclonal Antibody

27806-50ul 50ul
EUR 187

KIR2DL4 Rabbit pAb

A12836-100ul 100 ul
EUR 308

KIR2DL4 Rabbit pAb

A12836-200ul 200 ul
EUR 459

KIR2DL4 Rabbit pAb

A12836-20ul 20 ul
EUR 183

KIR2DL4 Rabbit pAb

A12836-50ul 50 ul
EUR 223

KIR2DL4 Blocking Peptide

33R-9831 100 ug
EUR 180
Description: A synthetic peptide for use as a blocking control in assays to test for specificity of KIR2DL4 antibody, catalog no. 70R-2365

KIR2DL4 cloning plasmid

CSB-CL857457HU-10ug 10ug
EUR 233
  • Formulation: 10 μg plasmid + 200μl Glycerol
  • Length: 1134
  • Sequence: atgtccatgtcacccacggtcatcatcctggcatgtcttgggttcttcttggaccagagtgtgtgggcacacgtgggtggtcaggacaagcccttctgctctgcctggcccagcgctgtggtgcctcaaggaggacacgtgactcttcggtgtcactatcgtcgtgggtttaaca
  • Show more
Description: A cloning plasmid for the KIR2DL4 gene.

pOTB7-KIR2DL4 Plasmid

PVTB00348 2 ug
EUR 356

KIR2DL4 ORF Vector (Human) (pORF)

ORF005681 1.0 ug DNA
EUR 95

KIR2DL4 Polyclonal Conjugated Antibody

C27806 100ul
EUR 397

pEGFP-flag-KIR2DL4 Plasmid

PVTB00348-2a 2 ug
EUR 356

KIR2DL4 sgRNA CRISPR Lentivector set (Human)

K1150301 3 x 1.0 ug
EUR 339

Polyclonal Goat anti-GST α-form

GST-ANTI-1 50 uL
EUR 280

Polyclonal Goat anti-GST μ-form

GST-ANTI-2 50 uL
EUR 280

Polyclonal Goat anti-GST p-form

GST-ANTI-3 50 uL
EUR 280


  • EUR 317.00
  • EUR 244.00
  • 100ul
  • 50ul
  • Form: Liquid
  • Buffer: -20°C, pH7.4 PBS, 0.05% NaN3, 40% Glycerol Antigen affinity purification
Description: A polyclonal antibody against KIR2DL3/KIR2DL1/KIR2DL4/KIR2DS4. Recognizes KIR2DL3/KIR2DL1/KIR2DL4/KIR2DS4 from Human. This antibody is Unconjugated. Tested in the following application: ELISA, IHC;ELISA:1:2000-1:5000, IHC:1:50-1:200


  • EUR 317.00
  • EUR 244.00
  • 100ul
  • 50ul
  • Form: Liquid
  • Buffer: -20°C, pH7.4 PBS, 0.05% NaN3, 40% Glycerol Antigen affinity purification
Description: A polyclonal antibody against KIR2DL3/KIR2DL1/KIR2DL4/KIR2DS4. Recognizes KIR2DL3/KIR2DL1/KIR2DL4/KIR2DS4 from Human. This antibody is Unconjugated. Tested in the following application: ELISA, IHC;ELISA:1:1000-1:2000, IHC:1:50-1:100

KIR2DL3 / KIR2DL1 / KIR2DL4 / KIR2DS4 Antibody

  • EUR 411.00
  • EUR 300.00
  • 100 ul
  • 50 ul
  • Shipped within 5-10 working days.

KIR2DL3 / KIR2DL1 / KIR2DL4 / KIR2DS4 Antibody

  • EUR 411.00
  • EUR 300.00
  • 100 ul
  • 50 ul
  • Shipped within 5-10 working days.

Recombinant Human KIR2DL4/CD158d/KIR103 (C-6His)

C310-10ug 10ug
EUR 131
Description: Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.4.

Recombinant Human KIR2DL4/CD158d/KIR103 (C-6His)

C310-1mg 1mg
EUR 2283
Description: Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.4.

Recombinant Human KIR2DL4/CD158d/KIR103 (C-6His)

C310-500ug 500ug
EUR 1613
Description: Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.4.

Recombinant Human KIR2DL4/CD158d/KIR103 (C-6His)

C310-50ug 50ug
EUR 273
Description: Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.4.

KIR2DL4 sgRNA CRISPR Lentivector (Human) (Target 1)

K1150302 1.0 ug DNA
EUR 154

KIR2DL4 sgRNA CRISPR Lentivector (Human) (Target 2)

K1150303 1.0 ug DNA
EUR 154

KIR2DL4 sgRNA CRISPR Lentivector (Human) (Target 3)

K1150304 1.0 ug DNA
EUR 154

KIR2DL4 Protein Vector (Human) (pPB-C-His)

PV022721 500 ng
EUR 329

KIR2DL4 Protein Vector (Human) (pPB-N-His)

PV022722 500 ng
EUR 329

KIR2DL4 Protein Vector (Human) (pPM-C-HA)

PV022723 500 ng
EUR 329

KIR2DL4 Protein Vector (Human) (pPM-C-His)

PV022724 500 ng
EUR 329

Recombinant Human KIR2DL4 Protein, His, Insect-1ug

QP12489-1ug 1ug
EUR 155

Recombinant Human KIR2DL4 Protein, His, Insect-50ug

QP12489-50ug 50ug
EUR 1261

Recombinant Human KIR2DL4 Protein, His, Insect-5ug

QP12489-5ug 5ug
EUR 201

KIR2DL4 3'UTR GFP Stable Cell Line

TU061796 1.0 ml
EUR 1521

KIR2DL4 3'UTR Luciferase Stable Cell Line

TU011796 1.0 ml
EUR 1521

KIR2DL4 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

K1150305 3 x 1.0 ug
EUR 376

Killer Cell Immunoglobulin-Like Receptor 2DL4 (KIR2DL4) Antibody

abx145740-100ug 100 ug
EUR 391
  • Shipped within 5-10 working days.

KIR2DL4 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)

K1150306 1.0 ug DNA
EUR 167

KIR2DL4 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)

K1150307 1.0 ug DNA
EUR 167

KIR2DL4 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

K1150308 1.0 ug DNA
EUR 167

KIR2DL4 Killer Cell Immunoglobulin-Like Receptor, 2 Domains Long Cytoplasmic Tail 4 Human Recombinant Protein

PROTQ99706 Regular: 5ug
EUR 317
Description: KIR2DL4 Human Recombinant produced in Sf9 Insect cells is a single, glycosylated polypeptide chain containing 458 amino acids (24-242 a.a.) and having a molecular mass of 51kDa (Molecular size on SDS-PAGE will appear at approximately 50-70kDa). KIR2DL4 is expressed with a 239 amino acids hIgG-His tag at C-Terminus and purified by proprietary chromatographic techniques. 

anti-human CCR1

20R-3028 200 ug
EUR 587
Description: Goat anti-human CCR1 antibody

anti-human RecQL4

AR05-PA0007 100 ul
EUR 334
Description: Rabbit polyclonal to human RecQL4

Anti-Human IgG

DB-173-0.1 100 μl
EUR 212
Description: rabbit monospecific clonal antibodies for ihc-p application; concentrated

Anti-Human IgG

DB-173-0.2 200 μl
EUR 298
Description: rabbit monospecific clonal antibodies for ihc-p application; concentrated

Anti-Human IgG

DB-173-0.5 500 μl
EUR 384
Description: rabbit monospecific clonal antibodies for ihc-p application; concentrated

Anti-Human IgG

DB-173-1 1 ml
EUR 613
Description: rabbit monospecific clonal antibodies for ihc-p application; concentrated

Anti-Human IgG

DB-173-RTU-15 15 ml
EUR 355
Description: rabbit monospecific clonal antibodies for ihc-p application; prediluted (ready to use)

Anti-Human IgG

DB-173-RTU-7 7 ml
EUR 231
Description: rabbit monospecific clonal antibodies for ihc-p application; prediluted (ready to use)

Anti-Human IgG

DB-174-0.1 100 μl
EUR 212
Description: rabbit monospecific clonal antibodies for ihc-p application; concentrated

Anti-Human IgG

DB-174-0.2 200 μl
EUR 298
Description: rabbit monospecific clonal antibodies for ihc-p application; concentrated

Anti-Human IgG

DB-174-0.5 500 μl
EUR 384
Description: rabbit monospecific clonal antibodies for ihc-p application; concentrated

Anti-Human IgG

DB-174-1 1 ml
EUR 613
Description: rabbit monospecific clonal antibodies for ihc-p application; concentrated

Anti-Human IgG

DB-174-RTU-15 15 ml
EUR 355
Description: rabbit monospecific clonal antibodies for ihc-p application; prediluted (ready to use)

Anti-Human IgG

DB-174-RTU-7 7 ml
EUR 231
Description: rabbit monospecific clonal antibodies for ihc-p application; prediluted (ready to use)

Anti-Human IgG

DB173RTU-15 15 ml
EUR 355
Description: rabbit monospecific clonal antibodies for ihc-p application; prediluted (ready to use)

Anti-Human IgG

DB173RTU-7 7 ml
EUR 231
Description: rabbit monospecific clonal antibodies for ihc-p application; prediluted (ready to use)

Anti-Human IgG

DB174RTU-15 15 ml
EUR 355
Description: rabbit monospecific clonal antibodies for ihc-p application; prediluted (ready to use)

Anti-Human IgG

DB174RTU-7 7 ml
EUR 231
Description: rabbit monospecific clonal antibodies for ihc-p application; prediluted (ready to use)

anti-human Albumin

LF-PA10001 100 ug
EUR 403
Description: Rabbit polyclonal to human Albumin

Human anti AMPH(anti amphiphysin) ELISA Kit

EH2621 96T
EUR 524.1
  • Detection range: 31.25-2000 pg/ml
  • Uniprot ID: P49418
  • Alias: anti-AMPH
Description: Method of detection: Sandwich ELISA, Double Antigen;Reacts with: Homo sapiens;Sensitivity: 18.75pg/ml

Human anti-TPO(anti-thrombopoietin) ELISA Kit

EH4147 96T
EUR 524.1
  • Detection range: 1.563-100 ng/ml
  • Alias: anti-TPO
Description: Method of detection: Sandwich ELISA, Double Antigen;Reacts with: Homo sapiens ;Sensitivity: 0.938 ng/ml

Goat anti-Human anti-thrombin polyclonal antibody

CABT-L487 500ug
EUR 715

Sheep anti-Human anti-thrombin polyclonal antibody

CABT-L488 500ug
EUR 663

Sheep anti-Human anti-thrombin polyclonal antibody

CABT-L489 100ug
EUR 663

Sheep anti-Human anti-thrombin polyclonal antibody

CABT-L490 100ug
EUR 663

Sheep anti-Human anti-thrombin polyclonal antibody

CABT-L491 100ug
EUR 663

Anti-Procalcitonin antibody *Mouse anti-human, monoclonal *

V100125 50 ug
EUR 306
  • R-phrase:
  • H-Phrase:
  • Symbol for dangerous compounds:
  • UNSPEC Code:

Anti-Procalcitonin antibody *Mouse anti-human, monoclonal *

V100126 1 mg
EUR 393
  • R-phrase:
  • H-Phrase:
  • Symbol for dangerous compounds:
  • UNSPEC Code:

Human Anti-Anti-Sperm Antibody Antibody (Anti-AsAb) ELISA Kit

AEA465Hu-10x96wellstestplate 10x96-wells test plate
EUR 5647.8
  • The Intra-assay Precision is determined when 3 samples with low, middle and high level of Human Anti-Anti-Sperm Antibody Antibody (Anti-AsAb) were tested on 3 different plates, 8 replicates in each plate
  • CV(%) = SD/meanX100
  • Intra-Assay: CV<10%
  • Int
  • Show more
Description: This is Competitive Enzyme-linked immunosorbent assay for Antibody Detection.detection of Human Anti-Anti-Sperm Antibody Antibody (Anti-AsAb) in serum, plasma and other biological fluids.

Human Anti-Anti-Sperm Antibody Antibody (Anti-AsAb) ELISA Kit

AEA465Hu-1x48wellstestplate 1x48-wells test plate
EUR 552.76
  • The Intra-assay Precision is determined when 3 samples with low, middle and high level of Human Anti-Anti-Sperm Antibody Antibody (Anti-AsAb) were tested on 3 different plates, 8 replicates in each plate
  • CV(%) = SD/meanX100
  • Intra-Assay: CV<10%
  • Int
  • Show more
Description: This is Competitive Enzyme-linked immunosorbent assay for Antibody Detection.detection of Human Anti-Anti-Sperm Antibody Antibody (Anti-AsAb) in serum, plasma and other biological fluids.

Human Anti-Anti-Sperm Antibody Antibody (Anti-AsAb) ELISA Kit

AEA465Hu-1x96wellstestplate 1x96-wells test plate
EUR 746.8
  • The Intra-assay Precision is determined when 3 samples with low, middle and high level of Human Anti-Anti-Sperm Antibody Antibody (Anti-AsAb) were tested on 3 different plates, 8 replicates in each plate
  • CV(%) = SD/meanX100
  • Intra-Assay: CV<10%
  • Int
  • Show more
Description: This is Competitive Enzyme-linked immunosorbent assay for Antibody Detection.detection of Human Anti-Anti-Sperm Antibody Antibody (Anti-AsAb) in serum, plasma and other biological fluids.

Human Anti-Anti-Sperm Antibody Antibody (Anti-AsAb) ELISA Kit

AEA465Hu-5x96wellstestplate 5x96-wells test plate
EUR 3060.6
  • The Intra-assay Precision is determined when 3 samples with low, middle and high level of Human Anti-Anti-Sperm Antibody Antibody (Anti-AsAb) were tested on 3 different plates, 8 replicates in each plate
  • CV(%) = SD/meanX100
  • Intra-Assay: CV<10%
  • Int
  • Show more
Description: This is Competitive Enzyme-linked immunosorbent assay for Antibody Detection.detection of Human Anti-Anti-Sperm Antibody Antibody (Anti-AsAb) in serum, plasma and other biological fluids.

Human Anti-Anti-Sperm Antibody Antibody (Anti-AsAb) ELISA Kit

  • EUR 5698.00
  • EUR 3011.00
  • EUR 747.00
  • 10 plates of 96 wells
  • 5 plates of 96 wells
  • 1 plate of 96 wells
  • Known also as Anti-Sperm Antibody elisa. Alternative names of the recognized antigen: Anti-Spermatozoa Antibodies
  • Sperm Antibodies
  • Antisperm Antibodies
Description: Enzyme-linked immunosorbent assay based on the Competitive Inhibition method for detection of Human Anti-Anti-Sperm Antibody Antibody (Anti-AsAb) in samples from serum, plasma and other biological fluids with no significant corss-reactivity with analogues from other species.

ELISA kit for Human Anti-AsAb (Anti-Anti-Sperm Antibody Antibody)

ELK8071 1 plate of 96 wells
EUR 432
  • The microtiter plate provided in this kit has been pre-coated with an antigen. Standards or samples are then added to the appropriate microtiter plate wells with a Horseradish Peroxidase (HRP)-conjugated secondary antibody. After TMB substrate soluti
  • Show more
Description: A competitive Inhibition ELISA kit for detection of Anti-Anti-Sperm Antibody Antibody from Human in samples from blood, serum, plasma, cell culture fluid and other biological fluids.

Sheep anti Human IgA

20C-CR6043SP 1 ml
EUR 221
Description: Sheep anti Human IgA antibody

Sheep anti Human IgA

20C-CR6043SP-S 1 ml
EUR 221
Description: Sheep anti Human IgA antibody

Goat anti Human IgM

70-B9022GA00-A0 5 mg
EUR 192
Description: Goat anti Human IgM antibody

Goat anti Human IgG

70C-CR6047GAP 1 mg
EUR 149
Description: Affinity purified Goat anti Human IgG antibody

Anti-CCR10 (human) Antibody

A04731 200ug
EUR 397
Description: Goat Polyclonal CCR10 (human) Antibody. Validated in ELISA, IF, IHC and tested in Human.

Mouse anti Human IgE

10R-I104d 1 mg
EUR 447
Description: Mouse anti Human IgE antibody

Mouse anti Human IgE

10R-I104e 1 mg
EUR 489
Description: Mouse anti Human IgE antibody

Mouse anti Human IgG1

10R-I110a 1 ml
EUR 554
Description: Mouse anti Human IgG1 antibody

Mouse anti Human IgG1

10R-I127a 1 mg
EUR 489
Description: Mouse anti Human IgG1 antibody

Mouse anti Human IgG2

10R-I128a 1 mg
EUR 489
Description: Mouse anti Human IgG2 antibody

Mouse anti Human IgG4

10R-I129a 1 mg
EUR 478
Description: Mouse anti Human IgG4 antibody

Mouse anti Human IgM

10R-I130a 1 mg
EUR 319
Description: Mouse anti Human IgM antibody

Mouse anti Human IgM

10R-I130B 1 mg
EUR 300
Description: Mouse anti Human IgM antibody

Mouse anti Human IgM

10C-CR2023M2 1 mg
EUR 154
Description: Mouse anti Human IgM antibody

Mouse anti Human IgM

10C-CR2023M3 1 mg
EUR 154
Description: Mouse anti Human IgM antibody

Mouse anti Human IgA

10C-CR6043M1 1 mg
EUR 241
Description: Mouse anti Human IgA antibody

Mouse anti Human IgE

10C-CR6046M3 1 mg
EUR 165
Description: Mouse anti Human IgE antibody

Mouse anti Human IgE

10C-CR6046M4 1 mg
EUR 165
Description: Mouse anti Human IgE antibody

Mouse anti Human IgE

10C-CR6046M5 1 mg
EUR 165
Description: Mouse anti Human IgE antibody

Mouse anti Human IgG

10C-CR6047M1 1 mg
EUR 176
Description: Mouse anti Human IgG antibody

Mouse anti Human IgG

10C-CR6047M2 1 mg
EUR 176
Description: Mouse anti Human IgG antibody

Mouse anti Human IgA

10-7808 1 mg
EUR 336
Description: Mouse anti Human IgA antibody

Mouse anti Human IgA

10-I05A 1 mg
EUR 308
Description: Mouse anti Human IgA antibody

Mouse anti Human IgE

10-I104B 1 mg
EUR 336
Description: Mouse anti Human IgE antibody

Mouse anti Human IgE

10-I104CC 1 mg
EUR 336
Description: Mouse anti Human IgE antibody

Mouse anti Human IgE

10-I10A 1 mg
EUR 181
Description: Mouse anti Human IgE antibody

Mouse anti Human IgE

10-I10C 1 mg
EUR 181
Description: Mouse anti Human IgE antibody

Mouse anti Human IgE

10-I10E 1 mg
EUR 495
Description: Mouse anti Human IgE antibody

Mouse anti Human IgM

10-I20A 1 mg
EUR 191
Description: Mouse anti Human IgM antibody

Mouse anti Human IgM

10-I20B 1 mg
EUR 295
Description: Mouse anti Human IgM antibody

Mouse anti Human IgM

10-I20G 1 mg
EUR 295
Description: Mouse anti Human IgM antibody

Mouse anti Human IgM

10-I20H 1 mg
EUR 187
Description: Mouse anti Human IgM antibody

Mouse anti Human IgG1

10-I21A 200 ug
EUR 220
Description: Mouse anti Human IgG1 antibody

Mouse anti Human IgG2

10-I22A 200 ug
EUR 392
Description: Mouse anti Human IgG2 antibody

Mouse anti Human IgG3

10-I23A 200 ug
EUR 635
Description: Mouse anti Human IgG3 antibody

Mouse anti Human IgG4

10-I24A 200 ug
EUR 392
Description: Mouse anti Human IgG4 antibody

Mouse anti Human IgE

10-S9601MND1-M0 1 mg
EUR 219
Description: Mouse anti Human IgE antibody

Sheep anti Human IgA

20-1266 1ml
EUR 647
Description: Sheep polyclonal Human IgA secondary antibody

Sheep anti Human IgG

20-1377 1ml
EUR 4723
Description: Sheep polyclonal Human IgG secondary antibody

Goat anti Human IgA

20-B9001G000-S0 10 ml
EUR 133
Description: Goat anti Human IgA antibody

Goat anti Human IgM

20-B9022G000-S2 10 ml
EUR 133
Description: Goat anti Human IgM antibody

Rabbit anti Human IgE

20-IR77 1 ml
EUR 192
Description: Rabbit anti Human IgE antibody

Goat anti Human IgA

20-S11030GND1-D 5 mg
EUR 192
Description: Goat anti Human IgA antibody

Goat anti Human IgA

20-S1103GND1-D0 10 ml
EUR 192
Description: Goat anti Human IgA antibody

Goat anti Human IgA

20-S1111G000-S4 10 ml
EUR 133
Description: Goat anti Human IgA antibody

Goat anti Human IgA

20-S1111G000-V0 10 ml
EUR 133
Description: Goat anti Human IgA antibody

Goat anti Human IgA

20-S1111GOOO-S4 10 ml
EUR 133
Description: Goat anti Human IgA antibody

Goat anti Human IgM

20-S1303GND1-D0 10 ml
EUR 192
Description: Goat anti Human IgM antibody

Goat anti Human IgM

20-S1304GA01 5 ml
EUR 138
Description: Goat anti Human IgM antibody

Goat anti Human IgM

20-S1311G000-S4 10 ml
EUR 133
Description: Goat anti Human IgM antibody

Goat anti Human IgM

20-S1311G000-V0 10 ml
EUR 111
Description: Goat anti Human IgM antibody

Goat anti Human IgM

20-S1311G001-S4 10 ml
EUR 133
Description: Goat anti Human IgM antibody

Goat anti Human IgE

20-S2001G000-S4 10 ml
EUR 127
Description: Goat anti Human IgE antibody

Goat anti Human IgE

20-S2001G000-V0 10 ml
EUR 133
Description: Goat anti Human IgE antibody

Goat anti Human IgE

20-S2001G000-VO 10 ml
EUR 133
Description: Goat anti Human IgE antibody

Goat anti Human IgE

20-S2003GND1-D0 10 ml
EUR 192
Description: Goat anti Human IgE antibody

Goat anti Human IgM

20-S4113GN00-D4 10 ml
EUR 192
Description: Goat anti Human IgM antibody

Goat anti Human IgM

20-S5170GND1-D0 10 ml
EUR 192
Description: Goat anti Human IgM antibody

Goat anti Human IgA

20-S5491G000-S4 10 ml
EUR 133
Description: Goat anti Human IgA antibody

Mouse anti Human IgE

10-1025 1 mg
EUR 327
Description: Mouse monoclonal Mouse anti Human IgE antibody

Mouse anti Human IgE

10-1026 1 mg
EUR 327
Description: Mouse monoclonal Mouse anti Human IgE antibody

Mouse anti Human IgE

10-1027 1 mg
EUR 327
Description: Mouse monoclonal Mouse anti Human IgE antibody

Rabbit anti Human IgG

40C-CB0943 1 mg
EUR 249
Description: Rabbit anti Human IgG secondary antibody

Rabbit anti Human IgG

40C-CB0950 5 mg
EUR 381
Description: Rabbit anti Human IgG secondary antibody

Rabbit anti Human IgG

40C-CB0971 2 mg
EUR 322
Description: Rabbit anti Human IgG secondary antibody

Rabbit anti Human IgM

40C-CB9100 2 mg
EUR 283
Description: Rabbit anti Human IgM secondary antibody

Rabbit anti Human IgA

40C-CB9114 2 mg
EUR 259
Description: Rabbit anti Human IgA secondary antibody

Sheep anti Human IgM

40C-CR2023S 1 ml
EUR 241
Description: Sheep anti Human IgM antibody

Mouse anti Human IgE

40R-1000 100 ug
EUR 265
Description: Mouse anti Human IgE antibody

Mouse anti Human IgA

40R-1001 100 ug
EUR 265
Description: Mouse anti Human IgA antibody

Leave a Reply

Your email address will not be published. Required fields are marked *