Biosystem for Modulation of Interactions between Antigen-Presenting Cells and T Cells

Biosystems Design by Machine Studying

Biosystems corresponding to enzymes, pathways, and complete cells have been more and more explored for biotechnological functions. Nevertheless, the intricate connectivity and ensuing complexity of biosystems poses a significant hurdle in designing biosystems with fascinating options. As -omics and different excessive throughput applied sciences have been quickly developed, the promise of making use of machine studying (ML) strategies in biosystems design has began to change into a actuality.

  • ML fashions allow the identification of patterns inside sophisticated organic information throughout a number of scales of study and might increase biosystems design functions by predicting new candidates for optimized efficiency.
  • ML is getting used at each stage of biosystems design to assist discover nonobvious engineering options with fewer design iterations. On this overview, we first describe generally used fashions and modeling paradigms inside ML.
  • We then focus on some functions of those fashions which have already proven success in biotechnological functions.
  • Furthermore, we focus on profitable functions in any respect scales of biosystems design, together with nucleic acids, genetic circuits, proteins, pathways, genomes, and bioprocesses. Lastly, we focus on some limitations of those strategies and potential options in addition to prospects of the mixture of ML and biosystems design.
uwmembraneprotein
uwmembraneprotein

Recombinant Human DKK-1 Protein

PROTO94907-3 10ug
EUR 380.4
Description: DKK-1 is a member of the DKK protein family which also includes DKK-2, DKK-3 and DKK-4. DKK-1 was originally identified as a Xenopus head forming molecule that behaves as an antagonist for Wnt signaling. Subsequent studies have shown that DKK-1 and DKK-4 play an important regulatory role in the Wnt /β-catenin signaling pathway by forming inhibitory complexes with LDL receptor-related proteins 5 and 6 (LRP5 and LRP6), which are essential components of the Wnt/βcatenin signaling system. LPR5 and LPR6 are single-pass transmembrane proteins that appear to act as co-receptors for Wnt ligands involved in the Wnt/βcatenin signaling cascade. It has been suggested that by inhibiting Wnt/β-catenin signaling, which is essential for posterior patterning in vertebrates, DKK-1 permits anterior development. This notion is supported by the finding that mice deficient of DKK-1 expression lack head formation and die during embryogenesis. Recombinant human DKK-1 expressed in human 293 cells is a 35-40 kDa glycoprotein containing 235 amino-acid residues.

Human CellExp? DKK-1, Human Recombinant

7132-10
EUR 333.6

Human CellExp? DKK-1, Human Recombinant

7132-50
EUR 1358.4

DKK-1 Recombinant Protein

40-225-0002mg 0.002 mg
EUR 311.1
Description: DKK-1 is a member of the DKK protein family which also includes DKK-2, DKK-3 and DKK-4. DKK-1 was originally identified as a Xenopus head forming molecule that behaves as an antagonist for Wnt signaling. Subsequent studies have shown that DKK-1 and DKK-4 play an important regulatory role in the Wnt /β-catenin signaling pathway by forming inhibitory complexes with LDL receptor-related proteins 5 and 6 (LRP5 and LRP6), which are essential components of the Wnt/βcatenin signaling system. LPR5 and LPR6 are single-pass transmembrane proteins that appear to act as co-receptors for Wnt ligands involved in the Wnt/βcatenin signaling cascade. It has been suggested that by inhibiting Wnt/β-catenin signaling, which is essential for posterior patterning in vertebrates, DKK-1 permits anterior development. This notion is supported by the finding that mice deficient of DKK-1 expression lack head formation and die during embryogenesis. Recombinant human DKK-1 expressed in human 293 cells is a 35-40 kDa glycoprotein containing 235 amino-acid residues.

DKK-1 Recombinant Protein

40-225-001mg 0.01 mg
EUR 437.1
Description: DKK-1 is a member of the DKK protein family which also includes DKK-2, DKK-3 and DKK-4. DKK-1 was originally identified as a Xenopus head forming molecule that behaves as an antagonist for Wnt signaling. Subsequent studies have shown that DKK-1 and DKK-4 play an important regulatory role in the Wnt /β-catenin signaling pathway by forming inhibitory complexes with LDL receptor-related proteins 5 and 6 (LRP5 and LRP6), which are essential components of the Wnt/βcatenin signaling system. LPR5 and LPR6 are single-pass transmembrane proteins that appear to act as co-receptors for Wnt ligands involved in the Wnt/βcatenin signaling cascade. It has been suggested that by inhibiting Wnt/β-catenin signaling, which is essential for posterior patterning in vertebrates, DKK-1 permits anterior development. This notion is supported by the finding that mice deficient of DKK-1 expression lack head formation and die during embryogenesis. Recombinant human DKK-1 expressed in human 293 cells is a 35-40 kDa glycoprotein containing 235 amino-acid residues.

Dkk-1 Polyclonal Antibody

41928-100ul 100ul
EUR 302.4

Dkk-1 Polyclonal Antibody

41928-50ul 50ul
EUR 224.4

Dkk-1 Polyclonal Antibody

ABP53293-003ml 0.03ml
EUR 189.6
Description: A polyclonal antibody for detection of Dkk-1 from Human, Mouse, Rat. This Dkk-1 antibody is for WB, IHC-P, ELISA. It is affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific immunogenand is unconjugated. The antibody is produced in rabbit by using as an immunogen synthesized peptide derived from the C-terminal region of human Dkk-1

Dkk-1 Polyclonal Antibody

ABP53293-01ml 0.1ml
EUR 346.8
Description: A polyclonal antibody for detection of Dkk-1 from Human, Mouse, Rat. This Dkk-1 antibody is for WB, IHC-P, ELISA. It is affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific immunogenand is unconjugated. The antibody is produced in rabbit by using as an immunogen synthesized peptide derived from the C-terminal region of human Dkk-1

Dkk-1 Polyclonal Antibody

ABP53293-02ml 0.2ml
EUR 496.8
Description: A polyclonal antibody for detection of Dkk-1 from Human, Mouse, Rat. This Dkk-1 antibody is for WB, IHC-P, ELISA. It is affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific immunogenand is unconjugated. The antibody is produced in rabbit by using as an immunogen synthesized peptide derived from the C-terminal region of human Dkk-1

DKK 1 Recombinant Protein

96-236 0.1 mg
EUR 752.1
Description: Members of the dickkopf-related protein family (DKK-1, -2, -3, and -4) are secreted proteins with two cysteine-rich domains separated by a linker region. And DKK1 takes part in embryonic development through its inhibition of the WNT signaling pathway, binds to LRP6 with high affinity and prevents the Frizzled-Wnt-LRP6 complex formation in response to Wnts. DKK1 promotes LRP6 internalization and degradation when it forms a ternary complex with the cell surface receptor Kremen.DKK1 not olny functions as a head inducer during development, but also regulates joint remodeling and bone formation, which suggests roles for DKK1 in the pathogenesis of rheumatoid arthritis and multiple myeloma. More recently research reported, DKK1 impacts eye development from a defined developmental time point on, and is critical for lens separation from the surface ectoderm via β-catenin mediated Pdgfrα and E-cadherin expression.

DKK 1 Recombinant Protein

96-237 0.025 mg
EUR 619.8
Description: Members of the dickkopf-related protein family (DKK-1, -2, -3, and -4) are secreted proteins with two cysteine-rich domains separated by a linker region. And DKK1 takes part in embryonic development through its inhibition of the WNT signaling pathway, binds to LRP6 with high affinity and prevents the Frizzled-Wnt-LRP6 complex formation in response to Wnts. DKK1 promotes LRP6 internalization and degradation when it forms a ternary complex with the cell surface receptor Kremen.DKK1 not olny functions as a head inducer during development, but also regulates joint remodeling and bone formation, which suggests roles for DKK1 in the pathogenesis of rheumatoid arthritis and multiple myeloma. More recently research reported, DKK1 impacts eye development from a defined developmental time point on, and is critical for lens separation from the surface ectoderm via β-catenin mediated Pdgfrα and E-cadherin expression.

Dkk-1 Recombinant Protein

96-861 0.1 mg
EUR 651.3
Description: Members of the dickkopf-related protein family (DKK-1, -2, -3, and -4) are secreted proteins with two cysteine-rich domains separated by a linker region. And DKK1 takes part in embryonic development through its inhibition of the WNT signaling pathway, binds to LRP6 with high affinity and prevents the Frizzled-Wnt-LRP6 complex formation in response to Wnts. DKK1 promotes LRP6 internalization and degradation when it forms a ternary complex with the cell surface receptor Kremen.DKK1 not olny functions as a head inducer during development, but also regulates joint remodeling and bone formation, which suggests roles for DKK1 in the pathogenesis of rheumatoid arthritis and multiple myeloma. More recently research reported, DKK1 impacts eye development from a defined developmental time point on, and is critical for lens separation from the surface ectoderm via beta-catenin mediated Pdgfralpha and E-cadherin expression.

Dkk-1 Recombinant Protein

96-990 0.05 mg
EUR 714.3
Description: Members of the dickkopf-related protein family (DKK-1, -2, -3, and -4) are secreted proteins with two cysteine-rich domains separated by a linker region. And DKK1 takes part in embryonic development through its inhibition of the WNT signaling pathway, binds to LRP6 with high affinity and prevents the Frizzled-Wnt-LRP6 complex formation in response to Wnts. DKK1 promotes LRP6 internalization and degradation when it forms a ternary complex with the cell surface receptor Kremen.DKK1 not olny functions as a head inducer during development, but also regulates joint remodeling and bone formation, which suggests roles for DKK1 in the pathogenesis of rheumatoid arthritis and multiple myeloma. More recently research reported, DKK1 impacts eye development from a defined developmental time point on, and is critical for lens separation from the surface ectoderm via beta-catenin mediated Pdgfralpha and E-cadherin expression.

Dkk-1 Polyclonal Antibody

ES4292-100ul 100ul
EUR 334.8
Description: A Rabbit Polyclonal antibody against Dkk-1 from Human/Mouse/Rat. This antibody is tested and validated for WB, ELISA, IHC, WB, ELISA

Dkk-1 Polyclonal Antibody

ES4292-50ul 50ul
EUR 248.4
Description: A Rabbit Polyclonal antibody against Dkk-1 from Human/Mouse/Rat. This antibody is tested and validated for WB, ELISA, IHC, WB, ELISA

Anti-Dkk-1 antibody

STJ97257 200 µl
EUR 236.4
Description: Rabbit polyclonal to Dkk-1.

Anti-Dkk-1 antibody

STJ98000 100 µl
EUR 280.8
Description: Mouse monoclonal to Dkk-1.

Dkk-2

GT15222 100 ug
EUR 631.2

Human DKK-1 PicoKine ELISA Kit

EK0867 96 wells
EUR 510
Description: For quantitative detection of human DKK1 in cell culture supernates, cell lysates, serum and plasma (heparin, EDTA).

ELISA kit for Human DKK-1

EK5390 96 tests
EUR 663.6
Description: Enzyme-linked immunosorbent assay kit for quantification of Human DKK-1 in samples from serum, plasma, tissue homogenates and other biological fluids.

Dkk-1 Polyclonal Conjugated Antibody

C41928 100ul
EUR 476.4

DKK-1 (CHO-expressed), Mouse

HY-P7154 50ug
EUR 914.4

Recombinant Mouse Dkk-1 Protein

RP01062 5 μg
EUR 219.6

Human DKK-1 ELISA kit (4×96T)

LF-EK50798 4×96T
EUR 2641.2

Nori® Human DKK-1 ELISA Kit

GR106268 96-well
EUR 553.2

Dkk-3 antibody

22898-100ul 100ul
EUR 468

DKK-3 ELISA KIT|Human

EF000091 96 Tests
EUR 826.8

Recombinant Human Dkk-3 Protein

RP00355 10 μg
EUR 196.8

ELISA kit for Rat DKK-1

EK5668 96 tests
EUR 663.6
Description: Enzyme-linked immunosorbent assay kit for quantification of Rat DKK-1 in samples from serum, plasma, tissue homogenates and other biological fluids.

Human DKK-1(Dickkopf-related protein 1) ELISA Kit

EH0113 96T
EUR 628.92
Description: Method of detection: Double Antibody, Sandwich ELISA;Reacts with: Homo sapiens;Sensitivity: 18.75pg/ml

Dkk-1 ELISA Kit (Human) : 96 Wells (OKAG00221)

OKAG00221 96 Wells
EUR 715.2
Description: Description of target: This gene encodes a protein that is a member of the dickkopf family. It is a secreted protein with two cysteine rich regions and is involved in embryonic development through its inhibition of the WNT signaling pathway. Elevated levels of DKK1 in bone marrow plasma and peripheral blood is associated with the presence of osteolytic bone lesions in patients with multiple myeloma.;Species reactivity: Human;Application: ELISA;Assay info: Quantitative Colorimentric Sandwich ELISA;Sensitivity: 63 pg/mL

DKK-2 Recombinant Protein

40-651 2 ug
EUR 311.1
Description: The dickkopf (DKK)-related protein family is comprised of four central members, DKK-1 - 4, along with the distantly-related DKK family member DKK-11 (Soggy), which is thought to be a descendent of an ancestral DKK-3 precursor due to its unique sequence homology to DKK-3 and no other DKK family member. DKK family members, with the exception of the divergent Soggy, share two conserved cysteine-rich domains and show very little sequence similarity outside of these domains. Playing an important regulatory role in vertebrate development through localized inhibition of Wnt-regulated processes, including anterior-posterior axial patterning, limb development, somitogenesis, and eye formation, DKKs have also been implicated post-developmentally in bone formation, bone disease, cancer, and neurodegenerative diseases. DKK proteins typically play an important regulatory role in the Wnt/β-catenin signaling pathway by forming inhibitory complexes with LDL receptor-related proteins 5 and 6 (LRP5 and LRP6), which are essential components of the Wnt/β-catenin signaling system. LRP5 and LRP6 are single-pass transmembrane proteins that appear to act as co-receptors for Wnt ligands involved in the Wnt/β-catenin signaling cascade. DKK-2 has been shown to both inhibit and enhance canonical Wnt signaling; enhancing Wnt signaling through direct high-affinity binding of DKK-2 to LRP6 during LRP6 overexpression, while inhibiting Wnt signaling and promoting LRP6 internalization through the formation of a ternary complex between DKK-2, LRP6, and Kremen-2. Recombinant Human DKK-2 expressed in CHO cells is a glycoprotein that has a calculated molecular weight of 25.8 kDa and contains 234 amino acid residues. Due to glycosylation, human DKK-2 migrates at an apparent molecular weight of approximately 31-36 kDa by SDS-PAGE analysis under non-reducing conditions.

DKK-3 Recombinant Protein

40-652 2 ug
EUR 311.1
Description: The dickkopf (DKK)-related protein family is comprised of four central members, DKK-1 - 4, along with the distantly-related DKK family member DKK-L1 (Soggy), which is thought to be a descendent of an ancestral DKK-3 precursor due to its unique sequence homology to DKK-3 and no other DKK family member. DKK family members, with the exception of the divergent Soggy, share two conserved cysteine-rich domains and show very little sequence similarity outside of these domains. Playing an important regulatory role in vertebrate development through localized inhibition of Wnt-regulated processes, including anterior-posterior axial patterning, limb development, somitogenesis, and eye formation, DKKs have also been implicated post-developmentally in bone formation, bone disease, cancer, and neurodegenerative diseases. DKK proteins typically play an important regulatory role in the Wnt/β-catenin signaling pathway by forming inhibitory complexes with LDL receptor-related proteins 5 and 6 (LRP5 and LRP6), which are essential components of the Wnt/β-catenin signaling system. LRP5 and LRP6 are single-pass transmembrane proteins that appear to act as co-receptors for Wnt ligands involved in the Wnt/β-catenin signaling cascade. DKK-3 has been shown to potentiate, rather than inhibit, Wnt signaling through interactions with the high-affinity, transmembrane co-receptors Kremen-1 (Krm1) and Kremen-2 (Krm2). Recombinant Human DKK-3 expressed in CHO cells is a glycoprotein that has a calculated molecular weight of 36.3 kDa and contains 329 amino acid residues. Due to glycosylation, Human DKK-3 migrates at an apparent molecular weight of approximately 39-49 kDa by SDS-PAGE analysis under non-reducing conditions.

Dkk-3 Polyclonal Antibody

ABP54542-003ml 0.03ml
EUR 189.6
Description: A polyclonal antibody for detection of Dkk-3 from Human, Mouse. This Dkk-3 antibody is for WB, ELISA. It is affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific immunogenand is unconjugated. The antibody is produced in rabbit by using as an immunogen synthesized peptide derived from the Internal region of human Dkk-3 at AA rangle: 80-160

Dkk-3 Polyclonal Antibody

ABP54542-01ml 0.1ml
EUR 346.8
Description: A polyclonal antibody for detection of Dkk-3 from Human, Mouse. This Dkk-3 antibody is for WB, ELISA. It is affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific immunogenand is unconjugated. The antibody is produced in rabbit by using as an immunogen synthesized peptide derived from the Internal region of human Dkk-3 at AA rangle: 80-160

Dkk-3 Polyclonal Antibody

ABP54542-02ml 0.2ml
EUR 496.8
Description: A polyclonal antibody for detection of Dkk-3 from Human, Mouse. This Dkk-3 antibody is for WB, ELISA. It is affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific immunogenand is unconjugated. The antibody is produced in rabbit by using as an immunogen synthesized peptide derived from the Internal region of human Dkk-3 at AA rangle: 80-160

DKK 3 Recombinant Protein

96-239 0.2 mg
EUR 821.4
Description: Members of the dickkopf-related protein family (DKK-1, -2, -3, and -4) are secreted proteins with two cysteine-rich domains separated by a linker region. And DKK3 has been proposed as tumour suppressor gene and a marker for tumour blood vessels. DKK3 is the only DKK family member abundantly expressed in normal lung, but silenced by promoter hypermethylation in a large fraction of lung cancer cell lines and lung tumors. Downregulation of DKK3 was correlated with tumor progression and expression of nuclear beta-catenin in lung tumors. Ectopic expression of DKK3 in lung cancer cells with DKK3 hypermethylation induced apoptosis and inhibited TCF-4 activity as well as nuclear accumulation of beta-catenin and expression of TCF-4 targets c-Myc and cyclin D1. DKK3 modulates FGF and Activin/Nodal signaling to regulate mesoderm induction during early Xenopus development, was reported.

Dkk-3 Recombinant Protein

96-991 0.05 mg
EUR 651.3
Description: Members of the dickkopf-related protein family (DKK-1, -2, -3, and -4) are secreted proteins with two cysteine-rich domains separated by a linker region. And DKK3 has been proposed as tumour suppressor gene and a marker for tumour blood vessels. DKK3 is the only DKK family member abundantly expressed in normal lung, but silenced by promoter hypermethylation in a large fraction of lung cancer cell lines and lung tumors. Downregulation of DKK3 was correlated with tumor progression and expression of nuclear beta-catenin in lung tumors. Ectopic expression of DKK3 in lung cancer cells with DKK3 hypermethylation induced apoptosis and inhibited TCF-4 activity as well as nuclear accumulation of beta-catenin and expression of TCF-4 targets c-Myc and cyclin D1. DKK3 modulates FGF and Activin/Nodal signaling to regulate mesoderm induction during early Xenopus development, was reported.

Dkk-3 Polyclonal Antibody

ES5541-100ul 100ul
EUR 334.8
Description: A Rabbit Polyclonal antibody against Dkk-3 from Human/Mouse. This antibody is tested and validated for WB, ELISA, WB, ELISA

Dkk-3 Polyclonal Antibody

ES5541-50ul 50ul
EUR 248.4
Description: A Rabbit Polyclonal antibody against Dkk-3 from Human/Mouse. This antibody is tested and validated for WB, ELISA, WB, ELISA

Anti-Dkk-3 antibody

STJ92720 200 µl
EUR 236.4
Description: Rabbit polyclonal to Dkk-3.

Anti-Dkk-3 antibody

STJ98001 100 µl
EUR 280.8
Description: Mouse monoclonal to Dkk-3.

DKK-3 ELISA Kit (Human) (OKBB00603)

OKBB00603 96 Wells
EUR 606
Description: Description of target: Dickkopf-related protein 3 is a protein that in humans is encoded by the DKK3 gene. This gene encodes a protein that is a member of the dickkopf family. It is mapped to 11p15.3. The secreted protein contains two cysteine rich regions and is involved in embryonic development through its interactions with the Wnt signaling pathway. The expression of this gene is decreased in a variety of cancer cell lines and it may function as a tumor suppressor gene. Members of the Dkk-related family display unique patterns of mRNA expression in human and mouse tissues, and are secreted when expressed in 293T cells. DKKs play an important role in vertebrate development, where they locally inhibit Wnt regulated processes such as antero-posterior axial patterning, limb development, somitogenesis and eye formation. In the adult, Dkks are implicated in bone formation and bone disease, cancer and Alzheimer disease.;Species reactivity: Human;Application: ELISA;Assay info: Assay Methodology: Quantitative Sandwich Immunoassay;Sensitivity: <= 10 pg/mL

Human DKK-4 PicoKine ELISA Kit

EK0868 96 wells
EUR 546
Description: For Quantitative Detection of human DKK-4 in cell culture supernates, serum and plasma(heparin, EDTA).

Human DKK-3 PicoKine ELISA Kit

EK1323 96 wells
EUR 510
Description: For quantitative detection of human DKK-3 in cell culture supernates, cell lysates, serum and plasma (heparin, EDTA).

Recombinant Human Dkk-3/DKK3 Protein

RP00209 10 μg
EUR 186

Nori® Human DKK-1 ELISA Kit (2 plates)

GR106268-2 2 x 96-well
EUR 998.4

Recombinant Dkk-1 Protein (Thr 32-His 266) [Fc]

VAng-1451Lsx-100g 100 µg
EUR 1017.6
Description: Human Dkk-1, Fc tag, is expressed in HEK 293 cells. (Uniprot ID: NP_036374.1)

Recombinant Dkk-1 Protein (Thr 32-His 266) [Fc]

VAng-1451Lsx-1mg 1 mg
EUR 5668.8
Description: Human Dkk-1, Fc tag, is expressed in HEK 293 cells. (Uniprot ID: NP_036374.1)

Recombinant Dkk-1 Protein (Thr 32-His 266) [His]

VAng-1453Lsx-100g 100 µg
EUR 1215.6
Description: Human Dkk-1, His tag, is expressed in HEK 293 cells. (Uniprot ID: NP_036374.1)

Recombinant Dkk-1 Protein (Thr 32-His 266) [His]

VAng-1453Lsx-1mg 1 mg
EUR 5998.8
Description: Human Dkk-1, His tag, is expressed in HEK 293 cells. (Uniprot ID: NP_036374.1)

Recombinant Dkk-1 Protein (Thr 32-His 266) [Strep]

VAng-1454Lsx-1mg 1 mg
EUR 7648.8
Description: Human Dkk-1, Fc tag, is expressed in HEK 293 cells. (Uniprot ID: NP_036374.1)

Recombinant Dkk-1 Protein (Thr 32-His 266) [Strep]

VAng-1454Lsx-250g 250 µg
EUR 2964
Description: Human Dkk-1, Fc tag, is expressed in HEK 293 cells. (Uniprot ID: NP_036374.1)

Recombinant Dkk-1 Protein (Thr 32-His 266) [Strep]

VAng-1454Lsx-25g 25 µg
EUR 918
Description: Human Dkk-1, Fc tag, is expressed in HEK 293 cells. (Uniprot ID: NP_036374.1)

Recombinant Dkk-1 Protein (Thr 32-His 272) [His]

VAng-1455Lsx-500g 500 µg
EUR 5338.8
Description: Mouse Dkk-1, His tag, is expressed in HEK 293 cells. (Uniprot ID: O54908)

Recombinant Dkk-1 Protein (Thr 32-His 272) [His]

VAng-1455Lsx-50g 50 µg
EUR 1215.6
Description: Mouse Dkk-1, His tag, is expressed in HEK 293 cells. (Uniprot ID: O54908)

Human DKK-3(Dickkopf-related protein 3) ELISA Kit

EH0114 96T
EUR 681.12
Description: Method of detection: Double Antibody, Sandwich ELISA;Reacts with: Homo sapiens;Sensitivity: 37.5pg/ml

Recombinant Dkk-1 Protein (Thr 32-His 266) [Fc] [Avi]

VAng-1452Lsx-200g 200 µg
EUR 4612.8
Description: Biotinylated Human Dkk-1, Fc tag and Avi tag, is expressed in HEK 293 cells. (Uniprot ID: O94907-1)

Recombinant Dkk-1 Protein (Thr 32-His 266) [Fc] [Avi]

VAng-1452Lsx-25g 25 µg
EUR 1215.6
Description: Biotinylated Human Dkk-1, Fc tag and Avi tag, is expressed in HEK 293 cells. (Uniprot ID: O94907-1)

Hemokinin 1 (human)

B5318-1 1 mg
EUR 408

Endothelin-1 (1-15), amide, human

A1111-1 1 mg
EUR 866.4
Description: Endothelins are 21-amino acid vasoconstricting peptides produced primarily in the endothelium and have a key role in vascular homeostasis.

Haptoglobin, (Phenotype 1-1) Human Plasma

7536-1
EUR 385.2

Recombinant Dkk-3 Protein (Pro 23-Ile 349) [His]

VAng-1456Lsx-1mg 1 mg
EUR 6592.8
Description: Mouse Dkk-3, His tag, is expressed in HEK 293 cells. (Uniprot ID: NP_056629.1)

Recombinant Dkk-3 Protein (Pro 23-Ile 349) [His]

VAng-1456Lsx-50g 50 µg
EUR 1017.6
Description: Mouse Dkk-3, His tag, is expressed in HEK 293 cells. (Uniprot ID: NP_056629.1)

Recombinant Dkk-3 Protein (Pro 23-Ile 350) [His]

VAng-1457Lsx-200g 200 µg
EUR 1347.6
Description: Human Dkk-3, His tag, is expressed in HEK 293 cells. (Uniprot ID: NP_001018067.1)

Recombinant Dkk-3 Protein (Pro 23-Ile 350) [His]

VAng-1457Lsx-20g 20 µg
EUR 456
Description: Human Dkk-3, His tag, is expressed in HEK 293 cells. (Uniprot ID: NP_001018067.1)

BNP (1-32), human

A1105-1 1 mg
EUR 212.4
Description: Basic natriuretic peptide (BNP), now known as B-type natriuretic peptide (also BNP) or GC-B, is a 32 amino acid polypeptide secreted by the ventricles of the heart in response to excessive stretching of heart muscle cells (cardiomyocytes).

IGF-1, human recombinant

P1016-.1 100 µg
EUR 915.6
Description: Insulin-like growth factor I (IGF-1) is a polypeptide endocrine hormone structurally similar to insulin and is mainly produced in the liver when stimulated by growth hormone. IGF-1 is a growth factor that stimulates the proliferation of various cell types including muscle, bone, and cartilage tissue

Neuregulin/Heregulin-1? (NRG-1?/HRG-1?), human recombinant protein

P1054-1 1 mg
EUR 4736.4
Description: Neuregulin (NRG) is a signaling protein for ErbB2/ErbB4 receptor heterodimers on the cardiac muscle cells and plays an important role in heart structure and function through inducing cardiomyocyte differentiation

Recombinant Human Dickkopf-Related Protein 2/DKK-2 (N-Fc, C-6His)

CC49-10ug 10ug
EUR 187.2
Description: Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl,pH7.2.

Recombinant Human Dickkopf-Related Protein 2/DKK-2 (N-Fc, C-6His)

CC49-1mg 1mg
EUR 2739.6
Description: Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl,pH7.2.

Recombinant Human Dickkopf-Related Protein 2/DKK-2 (N-Fc, C-6His)

CC49-500ug 500ug
EUR 1935.6
Description: Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl,pH7.2.

Recombinant Human Dickkopf-Related Protein 2/DKK-2 (N-Fc, C-6His)

CC49-50ug 50ug
EUR 442.8
Description: Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl,pH7.2.

IL1RL1 Human, Interleukin-1 Receptor Like-1 Human Recombinant Protein, Sf9

PROTQ01638-1 Regular: 10ug
EUR 380.4
Description: IL 1RL1 produced in Sf9 Baculovirus cells is a single, glycosylated polypeptide chain (19-328 a.a.) and fused to an 8 aa His Tag at C-terminus containing a total of 318 amino acids and having a molecular mass of 36.0kDa.;IL 1RL1 shows multiple bands between 40-57kDa on SDS-PAGE, reducing conditions and purified by proprietary chromatographic techniques.

MMP-1 Matrix Metalloproteinase-1 Human Recombinant Protein

PROTP03956-1 Regular: 20ug
EUR 380.4
Description: MMP 1 Human Recombinant produced in E.coli is a single, non-glycosylated polypeptide chain containing 393 amino acids (100-469a.a) and having a molecular mass of 45kDa. MMP 1 is fused to a 23 amino acid His-tag at N-terminus.

PSG1 Human, Pregnancy Specific Beta-1-Glycoprotein 1 Human Recombinant Protein, Sf9

PROTP11464-1 Regular: 10ug
EUR 380.4
Description: PSG1 Human Recombinant produced in Sf9 Baculovirus cells is a single, glycosylated polypeptide chain containing 394 amino acids (35-419a.a.) and having a molecular mass of 44.6kDa (Molecular size on SDS-PAGE will appear at approximately 40-57kDa). PSG1 is expressed with a 6 amino acids His tag at C-Terminus and purified by proprietary chromatographic techniques.

Parathyroid hormone (1-34) (human)

A1129-1 1 mg
EUR 199.2
Description: Parathyroid hormone (1-34) (human), (C181H291N55O51S2), a peptide with the sequence H2N-SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF-OH, MW= 4117.72.

Amyloid ?-Peptide (1-42) (human)

B6057-.1 100 ug
EUR 331.2

ApoA-1, human recombinant protein

P1052-.1 100 µg
EUR 375.6
Description: Apolipoprotein A-1 (ApoA-1) is a glycoprotein produced in the liver and intestine that is the major protein component of high density lipoprotein (HDL) particles. ApoA-1 is involved in the reverse transport of cholesterol from peripheral tissues to the liver for recycling and excretion.

ApoA-1, human recombinant protein

P1052-1 1 mg
EUR 1863.6
Description: Apolipoprotein A-1 (ApoA-1) is a glycoprotein produced in the liver and intestine that is the major protein component of high density lipoprotein (HDL) particles. ApoA-1 is involved in the reverse transport of cholesterol from peripheral tissues to the liver for recycling and excretion.

WNT-1, human recombinant protein

P1068-1 1 mg
EUR 8328
Description: The WNT gene family compose of structurally related genes that encode secreted signaling proteins. These proteins have been involved in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryogenesis.

Recombinant Human Gremlin-1 Protein

PROTO60565-1 50ug
EUR 380.4
Description: Gremlin-1 (isoform-1) belongs to a group of diffusible proteins which bind to ligands of the TGF-β family and regulate their activity by inhibiting their access to signaling receptors. The interplay between TGF-β ligands and their natural antagonists has major biological significance during development processes, in which cellular response can vary considerably depending upon the local concentration of the signaling molecule. Gremlin is highly expressed in the small intestine, fetal brain, and colon and lower expression in brain, prostate, pancreas and skeletal muscle.  Gremlin-1 regulates multiple functions in early development by specifically binding to and inhibiting the function of BMP-2, -4, and -7.  It also plays a role in carcinogenesis and kidney branching morphogenesis. Recombinant Gremlin-1 is a 18.3  kDa protein containing 160 amino acid residues.

ORM1 Orosomucoid 1 Human protein

PROTP02763-1 Regular: 10ug
EUR 380.4
Description: The Human Orosomucoid 1 produced from Human pooled serum has a molecular mass of 21.56kDa (calculated without glycosylation) containing 183 amino acid residues.

Recombinant Human Galectin-1 Protein

PROTP09382-1 50ug
EUR 380.4
Description: Lectins, of either plant or animal origin, are carbohydrate binding proteins that interact with glycoprotein and glycolipids on the surface of animal cells. The Galectins are lectins that recognize and interact with β-galactoside moieties. Galectin-1 is an animal lectin that has been shown to interact with CD3, CD4, and CD45. It induces apoptosis of activated T-cells and T-leukemia cell lines and inhibits the protein phosphatase activity of CD45. Recombinant human Galectin-1 is a 14.5 kDa protein containing 134 amino acid residues.

Recombinant Human PECAM-1 Protein

PROTP16284-1 50ug
EUR 380.4
Description: PECAM is transmembrane glycoprotein that belongs to the Ig-related superfamily of adhesion molecules. It is highly expressed at endothelial cell junctions, and also expressed in platelets and in most leukocyte sub-types. The primary function of PECAM-1 is the mediation of leukocyte-endothelial cell adhesion and signal transduction. PECAM-1 has been implicated in the pathogenesis of various inflammation related disorders, including thrombosis, multiple sclerosis (MS), and rheumatoid arthritis. The human PECAM-1 gene codes for a 738 amino acid transmembrane glycoprotein containing a 118 amino acid cytoplasmic domain, a 19 amino acid transmembrane domain, and a 574 amino acid extracellular domain. Recombinant human PECAM-1 is a 572 amino acid glycoprotein comprising the extracellular domain of PECAM-1. Monomeric glycosylated PECAM-1 migrates at an apparent molecular weight of approximately 80.0-95.0 kDa by SDS-PAGE analysis under reducing conditions

Recombinant Human ANG-1 Protein

PROTQ15389-1 20ug
EUR 380.4
Description: Angiopoietin-1 (Ang-1) is a secreted ligand for Tie-2, a tyrosine-kinase receptor expressed primarily on vascular endothelial cells and early hematopoietic cells. Ang-1/ Tie-2 signaling promotes angiogenesis during the development, remodeling, and repair of the vascular system. Transgenic mice lacking expression of either Ang-1 or Tie-2 fail to develop a fully functional cardiovascular system and die before birth. Postnatally, the angiogenic activity of Ang-1/Tie-2 is required during normal tissue repair and remodeling of the female endometrium in the menstrual cycle. Ang-1/Tie-2 signaling appears to be regulated by Angiopoietin-2 (Ang-2), a natural antagonist for Tie-2 that exerts its effects through an internal autocrine loop mechanism. In addition to suppressing endothelial cell activation by inhibiting the expression of adhesion and inflammatory molecules, Ang-1 enhances endothelial cell survival and capillary morphogenesis, and lessens capillary permeability. As such, Ang-1 has a potential to become an effective therapeutic agent for treating various endothelium disorders, including several severe human pulmonary diseases. The efficacy of cell-based Ang-1 gene therapy for acute lung injury (ALI) has recently been studied in a rat model of ALI (1). The results of this study show that such therapy can markedly improve lung condition and suggest that Ang-1 therapy may represent a potential new strategy for the treatment and/or prevention of acute respiratory distress injury (ARDI), a significant cause of morbidity and mortality in critically ill patients. Recombinant human ANG-1, derived from HeLa cells, is a C-terminal histidine tagged glycoprotein which migrates with an apparent molecular mass of 60.0 – 70.0 kDa by SDS-PAGE under reducing conditions. Sequencing analysis shows N-terminal sequences starting with Ser-20 and with Asp-70 of the 498 amino acid precursor protein.

(1-328) RAD51D (1-328 a.a.) Human Recombinant Protein

PROTO75771-1 Regular: 10ug
EUR 380.4
Description: RAD51D (1-328) Human Recombinant produced in E. coli is. a single polypeptide chain containing 351 amino acids and having a molecular mass of 37.4kDa. RAD51D (1-328) is fused to a 23 amino acid His-tag at N-terminus & purified by proprietary chromatographic techniques.

NXPH1 Human, Neurexophilin 1 Human Recombinant Protein, Sf9

PROTP58417-1 Regular: 10ug
EUR 380.4
Description: NXPH1 Human Recombinant produced in Sf9 Baculovirus cells is a single, glycosylated polypeptide chain containing 259 amino acids (22-271) and having a molecular mass of 29.7kDa (Molecular size on SDS-PAGE will appear at approximately 28-40kDa).;NXPH1 is fused to 9 amino acid His-Tag at C-terminus and purified by proprietary chromatographic techniques.

Human Interleukin-1 beta (IL-1 beta) AssayMax ELISA Kit

EI2200-1 96 Well Plate
EUR 572.4

Human Interleukin-1-alpha (IL-1-alpha) AssayMax ELISA Kit

EI2301-1 96 Well Plate
EUR 572.4

Human Plasminogen Activator Inhibitor-1 (PAI-1) AssayMax ELISA Kit

EP1100-1 96 Well Plate
EUR 500.4

Human KRAB-associated Protein 1 (KAP-1) AssayMax ELISA Kit

EK2802-1 96 Well Plate
EUR 572.4

TGF-b-1 Transforming Growth Factor-beta 1 Human protein

PROTP01137-1 Regular: 2.5ug
EUR 1388.4
Description: Human Transforming Growth Factor-beta 1 purified from Human Platelets having a molecular mass of 25kDa.;The TGF-b 1 is purified by proprietary chromatographic techniques.

MCP-1 Monocyte Chemotactic Protein-1 Human Recombinant Protein (CCL2)

PROTP13500-1 Regular: 20ug
EUR 380.4
Description: Monocyte Chemotactic Protein-1 Human Recombinant also known as Monocyte Chemotactic and Activating Factor (MCAF) produced in E.Coli is a non-glycosylated, Polypeptide chain containing 76 amino acids and having a molecular mass of 8.6kDa. ;The MCP-1 is purified by proprietary chromatographic techniques.

GAD1 iso1 Glutamate Decarboxylase 1 Isoform-1 Human Recombinant Protein

PROTQ99259-1 Regular: 20ug
EUR 380.4
Description: GAD1 iso1 Human Recombinant produced in E.Coli is a single, non-glycosylated polypeptide chain containing 617 amino acids (1-594 a.a) and having a molecular mass of 69.3kDa. GAD1 iso1 is fused to a 23 amino acid His-tag at N-terminus & purified by proprietary chromatographic techniques.

Ac-Endothelin-1 (16-21), human

A1016-1 1 mg
EUR 100.8
Description: ENDOTHELIN-1 (ET-1), the principal peptide of the endothelin family, has been shown to have a variety of biological activities in both vascular and nonvascular tissues, including the heart, the kidney, and the central nervous system.

Amyloid Beta-Peptide (1-40) (human)

A1124-1 1 mg
EUR 226.8
Description: Amyloid ?-Peptide (1-40) (human), (C194H295N53O58S1), a peptide with the sequence H2N-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA-OH, MW= 4329.8. Amyloid beta (A? or Abeta) is a peptide of 36-43 amino acids that is processed from the Amyloid precursor protein.

Brain natriuretic peptide (1-32) (human)

B5442-1 1 mg
EUR 621.6

Human Hexokinase-1 AssayMax ELISA Kit

EH3101-1 96 Well Plate
EUR 572.4

IFN-alpha 1, human recombinant protein

P1058-.1 100 µg
EUR 375.6
Description: IFN-?1 (also called IFN-?) is a lymphoid factor with potent antiviral antiproliferative and immunomodulatory properties. Human IFN-?1 is a 19.3 kDa protein containing 166 amino acid residues.

IFN-alpha 1, human recombinant protein

P1058-1 1 mg
EUR 2732.4
Description: IFN-?1 (also called IFN-?) is a lymphoid factor with potent antiviral antiproliferative and immunomodulatory properties. Human IFN-?1 is a 19.3 kDa protein containing 166 amino acid residues.

OryzaExp? IGF-1 LR3, Human Recombinant

P1399-1
EUR 1057.2

Human Glutaredoxin-1 AssayMax ELISA Kit

EG2153-1 96 Well Plate
EUR 500.4

Human Complexin-1 AssayMax ELISA Kit

EC3505-1 96 Well Plate
EUR 500.4

Recombinant Human sTRAIL Receptor-1 Protein

PROTO00220-1 50ug
EUR 380.4
Description: TRAIL Receptor-1/DR4 and TRAIL Receptor-2/DR5 belong to the TNFR superfamily of transmembrane proteins and contain a cytoplasmic "death domain, " which can activate the cell's apoptotic machinery. These receptors are activated by binding to either membrane anchored or soluble TRAIL/Apo2L. Recombinant human soluble TRAIL Receptor-1/DR4 is a 22.7 kDa protein (215 amino acid residues) consisting of the TNFR homologous, cysteine rich portion of the extracellular domain.

Recombinant Human LAG-1 (CCL4L1) Protein

PROTP13236-1 20ug
EUR 380.4
Description: LAG-1 is CC chemokine that signals through the CCR5 receptor. LAG-1 is identical to MIP-1β (ACT II isotype) except for two amino acid substitutions; arginine for histidine at position 22 and serine for glycine at position 47 of the mature protein. LAG-1 chemoattracts monocytes, and exhibits activity as an HIV suppressive factor. Recombinant human LAG-1 is a 7.7 kDa protein containing 69 amino acid residues.

SDC1 Syndecan-1 Human Recombinant Protein

PROTP18827-1 Regular: 20ug
EUR 380.4
Description: SDC1 Human Recombinant produced in E. coli is a single polypeptide chain containing 262 amino acids (18-254) and having a molecular mass of 27kDa (molecular size on SDS-PAGE will appear higher).;SDC1 is fused to a 25 amino acid His-tag at N-terminus & purified by proprietary chromatographic techniques.

Recombinant Human Heregulin Beta -1 Protein

PROTQ02297-1 50ug
EUR 380.4
Description: Neuregulin/Heregulin is a family of structurally related polypeptide growth factors derived from alternatively spliced genes (NRG1, NRG2, NRG3 and NRG4). To date, there are over 14 soluble and transmembrane proteins derived from the NRG1 gene. Proteolytic processing of the extracellular domain of the transmembrane NRG1 isoforms release soluble growth factors. HRG1-β1 contains an Ig domain and an EGF-like domain that is necessary for direct binding to receptor tyrosine kinases erb3 and erb4. This binding induces erb3 and erb4 heterodimerization with erb2, stimulating intrinsic kinase activity, which leads to tyrosine phosphorylation. Although HRG1-β1 biological effects is still unclear, it has been found to promote motility and invasiveness of breast cancer cells which may also involve up-regulation of expression and function of the autocrine motility-promoting factor (AMF). Recombinant human Heregulin-β1 (HRG1-β1) is a 7.5 kDa polypeptide consisting of only the EGF domain of Heregulin-β1 (65 amino acid residues).

CTF1 Cardiotrophin-1 Human Recombinant Protein

PROTQ16619-1 Regular: 10ug
EUR 380.4
Description: Cardiotrophin-1 Human Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 201 amino acids and having a molecular mass of 21.2kDa.;The CTF1 is purified by proprietary chromatographic techniques.

NNT1 Neurotrophin-1 Human Recombinant Protein

PROTQ9UBD9-1 Regular: 10ug
EUR 380.4
Description: Neurotrophin-1 Human Recombinant (28-225) produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 199 amino acids and having a molecular mass of 22kDa.;The NNT-1 is purified by proprietary chromatographic techniques.

HPSE Heparanase-1 Human Recombinant Protein

PROTQ9Y251-1 Regular: 20ug
EUR 380.4
Description: HPSE Human Recombinant produced in E.Coli is a single, non-glycosylated polypeptide chain containing 531 amino acids (36-543 a.a) and having a molecular mass of 60kDa.;HPSE is fused to a 23 amino acid His-tag at N-terminus.

TPST1 Human, Tyrosylprotein Sulfotransferase 1, sf9 Human Recombinant Protein

PROTO60507-1 Regular: 5ug
EUR 380.4
Description: TPST1 produced in Sf9 Baculovirus cells is a single, glycosylated polypeptide chain containing 354 amino acids (26-370 a.a.) and having a molecular mass of 40.6kDa (Migrates at 40-57kDa on SDS-PAGE under reducing conditions). 

ITGB1 Human, Integrin Beta 1 Human Recombinant Protein, Sf9

PROTP05556-1 Regular: 10ug
EUR 380.4
Description: ITGB1 Human Recombinant produced in Sf9 Baculovirus cells is a single, glycosylated polypeptide chain containing 716 amino acids (1-728) and having a molecular mass of 79.4kDa (Molecular size on SDS-PAGE will appear at approximately 70-100kDa). ITGB1 is fused to an 8 amino acid His-Tag at C-terminus and purified by proprietary chromatographic techniques. 

KLK1 Human, Kallikrein-1 Human Recombinant Protein, His Tag

PROTP06870-1 Regular: 10ug
EUR 380.4
Description: Kallikrein-1 Human Recombinant produced in E.coli is a single, non-glycosylated polypeptide chain containing 259 amino acids (25-262) and having a molecular mass of 28.7kDa.;KLK1 is fused to a 23 amino acid His-tag at N-terminus & purified by proprietary chromatographic techniques.

FOLR1 Human, Folate Receptor 1 Human Recombinant Protein, sf9

PROTP15328-1 Regular: 5ug
EUR 380.4
Description: FOLR1 Human Recombinant produced in Sf9 Baculovirus cells is a single, glycosylated polypeptide chain containing 218 amino acids (26-234a.a.) and having a molecular mass of 25.6kDa (Molecular size on SDS-PAGE will appear at approximately 28-40kDa).;FOLR1 is expressed with a 6 amino acid His tag at C-Terminus and purified by proprietary chromatographic techniques.

PGAM1 Human, Phosphoglycerate Mutase 1 Human Recombinant Protein, Active

PROTP18669-1 Regular: 10ug
EUR 380.4
Description: PGAM1 Human Recombinant produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 274 amino acids (1-254 a.a.) and having a molecular mass of 30.9 kDa. The PGAM1 is fused to a 20 amino acid His Tag at N-Terminus and purified by proprietary chromatographic techniques.

TPI1 Human, Triosephosphate Isomerase 1 Human Recombinant Protein, Active

PROTP60174-1 Regular: 10ug
EUR 380.4
Description: TPI1 produced in E.Coli is a single, non-glycosylated polypeptide chain containing 269 amino acids (1-249a.a.) and having a molecular mass of 28.8kDa.;TPI1 is fused to a 20 amino acid His-tag at N-terminus & purified by proprietary chromatographic techniques.

DLK1 Human, Delta-Like 1 Human Recombinant Protein, HEK

PROTP80370-1 Regular: 10ug
EUR 380.4
Description: DLK1 Human Recombinant produced in HEK293 Cells is a single, glycosylated, polypeptide chain (a.a 24-303) containing 290 amino acids including a 10 a.a C-terminal His tag. The total molecular mass is 31.2kDa (calculated). 

FSTL1 Human, Follistatin Like 1 Human Recombinant Protein, HEK

PROTQ12841-1 Regular: 10ug
EUR 380.4
Description: FSTL1 Human Recombinant produced in HEK293 cells is a single, glycosylated polypeptide chain (a.a 21-308) containing 296 amino acids including a 8 a.a C-terminal His tag. The total molecular mass is 33.8kDa (calculated).

Synthetic Biosystem for Modulation of Interactions between Antigen-Presenting Cells and T Cells

T cell activation is triggered by sign molecules on the floor of antigen-presenting cells (APC) and subsequent exertion of mobile forces. Deciphering the biomechanical and biochemical indicators on this advanced course of is of curiosity and can contribute to an enchancment in immunotherapy methods.

To handle underlying questions, coculture and biomimetic fashions are established. Mature dendritic cells (mDC) are first handled with cytochalasin B (CytoB), a cytoskeletal disruption agent identified to decrease obvious mobile stiffness and discount in T cell proliferation is noticed.

It’s tried to imitate mDC and T cell interactions utilizing polyacrylamide (PA) gels with outlined stiffness akin to mDC (0.2-25 kPa). Completely different ratios of anti-CD3 (aCD3) and anti-CD28 (aCD28) antibodies are immobilized onto PA gels.

The outcomes present T cell proliferation is triggered by each aCD3 and aCD28 in a stiffness-dependent method. Cells cultured on aCD3 immobilized on gels has considerably enhanced proliferation and IL-2 secretion, in comparison with aCD28. Moreover, ZAP70 phosphorylation is enhanced in stiffer substrate a in a aCD3-dependent method.

The biosystem supplies an strategy to review the discount of T cell proliferation noticed on CytoB-treated mDC. Total, the biosystem permits distinguishing the affect of biophysical and biochemical indicators of APC and T cell interactions in vitro.

Graphene-based nanomaterials in biosystems.

Graphene-based nanomaterials have emerged as a novel sort of supplies with distinctive physicochemical properties and quite a few functions in varied areas. On this overview, we summarize latest advances in finding out interactions between graphene and biosystems.

We first present a short introduction on graphene and its derivatives, after which focus on on the toxicology and biocompatibility of graphene, together with the extracellular interactions between graphene and biomacromolecules, mobile research of graphene, and in vivo toxicological results.

Subsequent, we concentrate on varied graphene-based sensible functions in antibacterial supplies, wound addressing, drug supply, and water purification. We lastly current views on challenges and future developments in these thrilling fields.

Preface: Management and Design of Biosystems.

Biosystems are dynamic networks pushed by cross-scale interactions between molecules, cells, tissues, organs and organisms. Latest advances in our understanding of the spatiotemporal regulation and group of biosystems have stimulated exploration of novel approaches to regulate and design biosystems at a number of organic scales.

Such new approaches embrace synthetic cell synthesis, technology of embryoids/organoids, reconstitution and manipulation of life occasions corresponding to getting old and replica, and multidisciplinary approaches utilizing theoretical and engineering applied sciences. These control-and-design methodologies are anticipated to open up a new avenue to understanding life occasions in addition to to supply the idea for novel design methods in medical sciences.

KIR2DL4 Recombinant Protein (Human)

RP017041 100 ug Ask for price

KIR2DL4 Rabbit pAb

A12836-100ul 100 ul
EUR 369.6

KIR2DL4 Rabbit pAb

A12836-200ul 200 ul
EUR 550.8

KIR2DL4 Rabbit pAb

A12836-20ul 20 ul
EUR 219.6

KIR2DL4 Rabbit pAb

A12836-50ul 50 ul
EUR 267.6

KIR2DL4 Blocking Peptide

33R-9831 100 ug
EUR 216
Description: A synthetic peptide for use as a blocking control in assays to test for specificity of KIR2DL4 antibody, catalog no. 70R-2365

KIR2DL4 Polyclonal Antibody

27806-100ul 100ul
EUR 302.4

KIR2DL4 Polyclonal Antibody

27806-50ul 50ul
EUR 224.4

KIR2DL4 Recombinant Protein

91-290 0.05 mg
EUR 556.8
Description: Killer cell immunoglobulin-like receptor 2DL4(KIR2DL4) is a Single-pass type I membrane protein and contains 2 Ig-like C2-type (immunoglobulin-like) domains.It belongs to the immunoglobulin superfamily. KIR2DL4 is expressed in all NK cells and some T cells. KIR2DL4 activates the cytotoxicity of NK cells, despite the presence of an immunoreceptor tyrosine-based inhibition motif (ITIM) in its cytoplasmic tail. The ITIM was not necessary for activation of lysis by KIR2DL4. The activation signal of KIR2DL4 was sensitive to inhibition by another ITIM-containing receptor. The activation-deficient mutant of KIR2DL4 inhibited the signal delivered by the activating receptor CD16.

KIR2DL4 cloning plasmid

CSB-CL857457HU-10ug 10ug
EUR 279.6
Description: A cloning plasmid for the KIR2DL4 gene.

pOTB7-KIR2DL4 Plasmid

PVTB00348 2 ug
EUR 427.2

KIR2DL4 ORF Vector (Human) (pORF)

ORF005681 1.0 ug DNA
EUR 114

KIR2DL4 Polyclonal Conjugated Antibody

C27806 100ul
EUR 476.4

pEGFP-flag-KIR2DL4 Plasmid

PVTB00348-2a 2 ug
EUR 427.2

KIR2DL4 sgRNA CRISPR Lentivector set (Human)

K1150301 3 x 1.0 ug
EUR 406.8

Polyclonal Goat anti-GST α-form

GST-ANTI-1 50 uL
EUR 336

Polyclonal Goat anti-GST μ-form

GST-ANTI-2 50 uL
EUR 336

Polyclonal Goat anti-GST p-form

GST-ANTI-3 50 uL
EUR 336

KIR2DL3 / KIR2DL1 / KIR2DL4 / KIR2DS4 Antibody

20-abx339417
  • EUR 493.20
  • EUR 360.00
  • 100 ul
  • 50 ul

KIR2DL3 / KIR2DL1 / KIR2DL4 / KIR2DS4 Antibody

20-abx210854
  • EUR 493.20
  • EUR 360.00
  • 100 ul
  • 50 ul

KIR2DL3/KIR2DL1/KIR2DL4/KIR2DS4 Antibody

1-CSB-PA205578
  • EUR 380.40
  • EUR 292.80
  • 100ul
  • 50ul
Description: A polyclonal antibody against KIR2DL3/KIR2DL1/KIR2DL4/KIR2DS4. Recognizes KIR2DL3/KIR2DL1/KIR2DL4/KIR2DS4 from Human. This antibody is Unconjugated. Tested in the following application: ELISA, IHC;ELISA:1:2000-1:5000, IHC:1:50-1:200

KIR2DL3/KIR2DL1/KIR2DL4/KIR2DS4 Antibody

1-CSB-PA246816
  • EUR 380.40
  • EUR 292.80
  • 100ul
  • 50ul
Description: A polyclonal antibody against KIR2DL3/KIR2DL1/KIR2DL4/KIR2DS4. Recognizes KIR2DL3/KIR2DL1/KIR2DL4/KIR2DS4 from Human. This antibody is Unconjugated. Tested in the following application: ELISA, IHC;ELISA:1:1000-1:2000, IHC:1:50-1:100

Recombinant Human KIR2DL4/CD158d/KIR103 (C-6His)

C310-10ug 10ug
EUR 157.2
Description: Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.4.

Recombinant Human KIR2DL4/CD158d/KIR103 (C-6His)

C310-1mg 1mg
EUR 2739.6
Description: Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.4.

Recombinant Human KIR2DL4/CD158d/KIR103 (C-6His)

C310-500ug 500ug
EUR 1935.6
Description: Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.4.

Recombinant Human KIR2DL4/CD158d/KIR103 (C-6His)

C310-50ug 50ug
EUR 327.6
Description: Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.4.

KIR2DL4 sgRNA CRISPR Lentivector (Human) (Target 1)

K1150302 1.0 ug DNA
EUR 184.8

KIR2DL4 sgRNA CRISPR Lentivector (Human) (Target 2)

K1150303 1.0 ug DNA
EUR 184.8

KIR2DL4 sgRNA CRISPR Lentivector (Human) (Target 3)

K1150304 1.0 ug DNA
EUR 184.8

KIR2DL4 Protein Vector (Human) (pPB-C-His)

PV022721 500 ng
EUR 394.8

KIR2DL4 Protein Vector (Human) (pPB-N-His)

PV022722 500 ng
EUR 394.8

KIR2DL4 Protein Vector (Human) (pPM-C-HA)

PV022723 500 ng
EUR 394.8

KIR2DL4 Protein Vector (Human) (pPM-C-His)

PV022724 500 ng
EUR 394.8

Recombinant Human KIR2DL4 Protein, His, Insect-1ug

QP12489-1ug 1ug
EUR 186

Recombinant Human KIR2DL4 Protein, His, Insect-50ug

QP12489-50ug 50ug
EUR 1513.2

Recombinant Human KIR2DL4 Protein, His, Insect-5ug

QP12489-5ug 5ug
EUR 241.2

KIR2DL4 3'UTR Luciferase Stable Cell Line

TU011796 1.0 ml
EUR 1825.2

KIR2DL4 3'UTR GFP Stable Cell Line

TU061796 1.0 ml
EUR 1825.2

KIR2DL4 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

K1150305 3 x 1.0 ug
EUR 451.2

Killer Cell Immunoglobulin-Like Receptor 2DL4 (KIR2DL4) Antibody

abx145740-100ug 100 ug
EUR 469.2

KIR2DL4 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)

K1150306 1.0 ug DNA
EUR 200.4

KIR2DL4 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)

K1150307 1.0 ug DNA
EUR 200.4

KIR2DL4 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

K1150308 1.0 ug DNA
EUR 200.4

KIR2DL4 Killer Cell Immunoglobulin-Like Receptor, 2 Domains Long Cytoplasmic Tail 4 Human Recombinant Protein

PROTQ99706 Regular: 5ug
EUR 380.4
Description: KIR2DL4 Human Recombinant produced in Sf9 Insect cells is a single, glycosylated polypeptide chain containing 458 amino acids (24-242 a.a.) and having a molecular mass of 51kDa (Molecular size on SDS-PAGE will appear at approximately 50-70kDa). KIR2DL4 is expressed with a 239 amino acids hIgG-His tag at C-Terminus and purified by proprietary chromatographic techniques. 

anti-human CCR1

20R-3028 200 ug
EUR 704.4
Description: Goat anti-human CCR1 antibody

anti-human RecQL4

AR05-PA0007 100 ul
EUR 400.8
Description: Rabbit polyclonal to human RecQL4

Anti-Human IgG

DB-173-0.1 100 μl
EUR 254.4
Description: rabbit monospecific clonal antibodies for ihc-p application; concentrated

Anti-Human IgG

DB-173-0.2 200 μl
EUR 357.6
Description: rabbit monospecific clonal antibodies for ihc-p application; concentrated

Anti-Human IgG

DB-173-0.5 500 μl
EUR 460.8
Description: rabbit monospecific clonal antibodies for ihc-p application; concentrated

Anti-Human IgG

DB-173-1 1 ml
EUR 735.6
Description: rabbit monospecific clonal antibodies for ihc-p application; concentrated

Anti-Human IgG

DB-173-RTU-15 15 ml
EUR 426
Description: rabbit monospecific clonal antibodies for ihc-p application; prediluted (ready to use)

Anti-Human IgG

DB-173-RTU-7 7 ml
EUR 277.2
Description: rabbit monospecific clonal antibodies for ihc-p application; prediluted (ready to use)

Anti-Human IgG

DB-174-0.1 100 μl
EUR 254.4
Description: rabbit monospecific clonal antibodies for ihc-p application; concentrated

Anti-Human IgG

DB-174-0.2 200 μl
EUR 357.6
Description: rabbit monospecific clonal antibodies for ihc-p application; concentrated

Anti-Human IgG

DB-174-0.5 500 μl
EUR 460.8
Description: rabbit monospecific clonal antibodies for ihc-p application; concentrated

Anti-Human IgG

DB-174-1 1 ml
EUR 735.6
Description: rabbit monospecific clonal antibodies for ihc-p application; concentrated

Anti-Human IgG

DB-174-RTU-15 15 ml
EUR 426
Description: rabbit monospecific clonal antibodies for ihc-p application; prediluted (ready to use)

Anti-Human IgG

DB-174-RTU-7 7 ml
EUR 277.2
Description: rabbit monospecific clonal antibodies for ihc-p application; prediluted (ready to use)

Anti-Human IgG

DB173RTU-15 15 ml
EUR 426
Description: rabbit monospecific clonal antibodies for ihc-p application; prediluted (ready to use)

Anti-Human IgG

DB173RTU-7 7 ml
EUR 277.2
Description: rabbit monospecific clonal antibodies for ihc-p application; prediluted (ready to use)

Anti-Human IgG

DB174RTU-15 15 ml
EUR 426
Description: rabbit monospecific clonal antibodies for ihc-p application; prediluted (ready to use)

Anti-Human IgG

DB174RTU-7 7 ml
EUR 277.2
Description: rabbit monospecific clonal antibodies for ihc-p application; prediluted (ready to use)

anti-human Albumin

LF-PA10001 100 ug
EUR 483.6
Description: Rabbit polyclonal to human Albumin

Goat anti-Human anti-thrombin polyclonal antibody

CABT-L487 500ug
EUR 858

Sheep anti-Human anti-thrombin polyclonal antibody

CABT-L488 500ug
EUR 795.6

Sheep anti-Human anti-thrombin polyclonal antibody

CABT-L489 100ug
EUR 795.6

Sheep anti-Human anti-thrombin polyclonal antibody

CABT-L490 100ug
EUR 795.6

Sheep anti-Human anti-thrombin polyclonal antibody

CABT-L491 100ug
EUR 795.6

Human anti AMPH(anti amphiphysin) ELISA Kit

EH2621 96T
EUR 628.92
Description: Method of detection: Sandwich ELISA, Double Antigen;Reacts with: Homo sapiens;Sensitivity: 18.75pg/ml

Human anti-TPO(anti-thrombopoietin) ELISA Kit

EH4147 96T
EUR 628.92
Description: Method of detection: Sandwich ELISA, Double Antigen;Reacts with: Homo sapiens ;Sensitivity: 0.938 ng/ml

Anti-Procalcitonin antibody *Mouse anti-human, monoclonal *

V100125 50 ug
EUR 367.2

Anti-Procalcitonin antibody *Mouse anti-human, monoclonal *

V100126 1 mg
EUR 471.6

Human Anti-Anti-Sperm Antibody Antibody (Anti-AsAb) ELISA Kit

AEA465Hu-10x96wellstestplate 10x96-wells test plate
EUR 6777.36
Description: This is Competitive Enzyme-linked immunosorbent assay for Antibody Detection.detection of Human Anti-Anti-Sperm Antibody Antibody (Anti-AsAb) in serum, plasma and other biological fluids.

Human Anti-Anti-Sperm Antibody Antibody (Anti-AsAb) ELISA Kit

AEA465Hu-1x48wellstestplate 1x48-wells test plate
EUR 663.31
Description: This is Competitive Enzyme-linked immunosorbent assay for Antibody Detection.detection of Human Anti-Anti-Sperm Antibody Antibody (Anti-AsAb) in serum, plasma and other biological fluids.

Human Anti-Anti-Sperm Antibody Antibody (Anti-AsAb) ELISA Kit

AEA465Hu-1x96wellstestplate 1x96-wells test plate
EUR 896.16
Description: This is Competitive Enzyme-linked immunosorbent assay for Antibody Detection.detection of Human Anti-Anti-Sperm Antibody Antibody (Anti-AsAb) in serum, plasma and other biological fluids.

Human Anti-Anti-Sperm Antibody Antibody (Anti-AsAb) ELISA Kit

AEA465Hu-5x96wellstestplate 5x96-wells test plate
EUR 3672.72
Description: This is Competitive Enzyme-linked immunosorbent assay for Antibody Detection.detection of Human Anti-Anti-Sperm Antibody Antibody (Anti-AsAb) in serum, plasma and other biological fluids.

Human Anti-Anti-Sperm Antibody Antibody (Anti-AsAb) ELISA Kit

4-AEA465Hu
  • EUR 6837.60
  • EUR 3613.20
  • EUR 896.40
  • 10 plates of 96 wells
  • 5 plates of 96 wells
  • 1 plate of 96 wells
Description: Enzyme-linked immunosorbent assay based on the Competitive Inhibition method for detection of Human Anti-Anti-Sperm Antibody Antibody (Anti-AsAb) in samples from serum, plasma and other biological fluids with no significant corss-reactivity with analogues from other species.

Goat anti Human IgG

70C-CR6047GAP 1 mg
EUR 178.8
Description: Affinity purified Goat anti Human IgG antibody

Goat anti Human IgM

70-B9022GA00-A0 5 mg
EUR 230.4
Description: Goat anti Human IgM antibody

Mouse anti Human IgE

10-1025 1 mg
EUR 392.4
Description: Mouse monoclonal Mouse anti Human IgE antibody

Mouse anti Human IgE

10-1026 1 mg
EUR 392.4
Description: Mouse monoclonal Mouse anti Human IgE antibody

Mouse anti Human IgE

10-1027 1 mg
EUR 392.4
Description: Mouse monoclonal Mouse anti Human IgE antibody

Mouse anti Human IgA

10-7808 1 mg
EUR 403.2
Description: Mouse anti Human IgA antibody

Mouse anti Human IgA

10-I05A 1 mg
EUR 369.6
Description: Mouse anti Human IgA antibody

Mouse anti Human IgE

10-I104B 1 mg
EUR 403.2
Description: Mouse anti Human IgE antibody

Mouse anti Human IgE

10-I104CC 1 mg
EUR 403.2
Description: Mouse anti Human IgE antibody

Mouse anti Human IgE

10-I10A 1 mg
EUR 217.2
Description: Mouse anti Human IgE antibody

Mouse anti Human IgE

10-I10C 1 mg
EUR 217.2
Description: Mouse anti Human IgE antibody

Mouse anti Human IgE

10-I10E 1 mg
EUR 594
Description: Mouse anti Human IgE antibody

Mouse anti Human IgM

10-I20A 1 mg
EUR 229.2
Description: Mouse anti Human IgM antibody

Mouse anti Human IgM

10-I20B 1 mg
EUR 354
Description: Mouse anti Human IgM antibody

Mouse anti Human IgM

10-I20G 1 mg
EUR 354
Description: Mouse anti Human IgM antibody

Mouse anti Human IgM

10-I20H 1 mg
EUR 224.4
Description: Mouse anti Human IgM antibody

Mouse anti Human IgG1

10-I21A 200 ug
EUR 264
Description: Mouse anti Human IgG1 antibody

Mouse anti Human IgG2

10-I22A 200 ug
EUR 470.4
Description: Mouse anti Human IgG2 antibody

Mouse anti Human IgG3

10-I23A 200 ug
EUR 762
Description: Mouse anti Human IgG3 antibody

Mouse anti Human IgG4

10-I24A 200 ug
EUR 470.4
Description: Mouse anti Human IgG4 antibody

Mouse anti Human IgE

10-S9601MND1-M0 1 mg
EUR 262.8
Description: Mouse anti Human IgE antibody

Anti-CCR10 (human) Antibody

A04731 200ug
EUR 476.4
Description: Goat Polyclonal CCR10 (human) Antibody. Validated in ELISA, IF, IHC and tested in Human.

Anti-TRAIL (human) Antibody

A00466-2 100ul
EUR 500.4
Description: Rabbit Polyclonal TRAIL (human) Antibody. Validated in IF, IHC and tested in Human.

Anti-CCR4 (human) Antibody

A00755-1 200ug
EUR 476.4
Description: Goat Polyclonal CCR4 (human) Antibody. Validated in IF, IHC and tested in Human.

Goat anti Human IgG

41C-CB0957 5 mg
EUR 415.2
Description: Goat anti Human IgG secondary antibody

Goat anti Human IgG

41C-CB0972 2 mg
EUR 316.8
Description: Goat anti Human IgG secondary antibody

Goat anti Human IgM

41C-CB0993 1 mg
EUR 244.8
Description: Goat anti Human IgM secondary antibody

Goat anti Human IgG

41R-1026 2 mg
EUR 164.4
Description: Goat anti Human IgG secondary antibody

Goat anti Human IgG

41R-1027 2 mg
EUR 223.2
Description: Goat anti Human IgG secondary antibody

Goat anti Human IgG

41R-1028 1 mg
EUR 218.4
Description: Goat anti Human IgG secondary antibody

Goat anti Human IgG

41R-1029 2 mg
EUR 223.2
Description: Goat anti Human IgG secondary antibody

Goat anti Human IgG

41R-1030 1 mg
EUR 165.6
Description: Goat anti Human IgG secondary antibody

Goat anti Human IgG

41R-1031 1 mg
EUR 223.2
Description: Goat anti Human IgG secondary antibody

Goat anti Human IgG

41R-1032 1 mg
EUR 268.8
Description: Goat anti Human IgG secondary antibody

Goat anti Human IgG

41R-1033 1 mg
EUR 295.2
Description: Goat anti Human IgG secondary antibody

Goat anti Human IgG

41R-1034 1 mg
EUR 223.2
Description: Goat anti Human IgG secondary antibody

Mouse anti Human IgM

41R-1586 100 ug
EUR 318
Description: Monoclonal Mouse anti Human IgM antibody

Rabbit anti Human IgG

40C-CB0943 1 mg
EUR 298.8
Description: Rabbit anti Human IgG secondary antibody

Rabbit anti Human IgG

40C-CB0950 5 mg
EUR 457.2
Description: Rabbit anti Human IgG secondary antibody

Rabbit anti Human IgG

40C-CB0971 2 mg
EUR 386.4
Description: Rabbit anti Human IgG secondary antibody

Rabbit anti Human IgM

40C-CB9100 2 mg
EUR 339.6
Description: Rabbit anti Human IgM secondary antibody

Rabbit anti Human IgA

40C-CB9114 2 mg
EUR 310.8
Description: Rabbit anti Human IgA secondary antibody

Sheep anti Human IgM

40C-CR2023S 1 ml
EUR 289.2
Description: Sheep anti Human IgM antibody

Mouse anti Human IgE

40R-1000 100 ug
EUR 318
Description: Mouse anti Human IgE antibody

Mouse anti Human IgA

40R-1001 100 ug
EUR 318
Description: Mouse anti Human IgA antibody

Mouse anti Human IgG

40R-1003 100 ug
EUR 318
Description: Mouse anti Human IgG antibody

Mouse anti Human IgE

40R-1004 100 ug
EUR 318
Description: Mouse anti Human IgE antibody

Mouse anti Human IgM

40R-1005 100 ug
EUR 318
Description: Mouse anti Human IgM antibody

Mouse anti Human IgA

40R-1006 100 ug
EUR 318
Description: Mouse anti Human IgA antibody

Rat anti Human IgG1

40R-1007 100 ug
EUR 318
Description: Rat monoclonal Rat anti Human IgG1 antibody

Mouse anti Human IgA

40R-1011 500 ug
EUR 678
Description: Mouse anti Human IgA secondary antibody

Mouse anti Human IgA

40R-1012 500 ug
EUR 678
Description: Mouse anti Human IgA secondary antibody

Mouse anti Human IgG3

40R-1015 1 mg
EUR 496.8
Description: Mouse anti Human IgG3 antibody

Rat anti Human IgG

40R-1588 100 ug
EUR 318
Description: Rat monoclonal Rat anti Human IgG antibody

Goat anti Human IgG

41-XG56 1 mg
EUR 121.2
Description: Goat anti Human IgG secondary antibody

Sheep anti Human IgA

20C-CR6043SP 1 ml
EUR 265.2
Description: Sheep anti Human IgA antibody

Sheep anti Human IgA

20C-CR6043SP-S 1 ml
EUR 265.2
Description: Sheep anti Human IgA antibody

Goat anti Human IgE

40-IG10 1 ml
EUR 159.6
Description: Goat anti Human IgE antibody

Sheep anti Human IgE

40-IG11 1 ml
EUR 159.6
Description: Sheep anti Human IgE antibody

Sheep anti Human IgA

20-1266 1ml
EUR 776.4
Description: Sheep polyclonal Human IgA secondary antibody

Sheep anti Human IgG

20-1377 1ml
EUR 5667.6
Description: Sheep polyclonal Human IgG secondary antibody

Goat anti Human IgA

20-B9001G000-S0 10 ml
EUR 159.6
Description: Goat anti Human IgA antibody

Goat anti Human IgM

20-B9022G000-S2 10 ml
EUR 159.6
Description: Goat anti Human IgM antibody

Rabbit anti Human IgE

20-IR77 1 ml
EUR 230.4
Description: Rabbit anti Human IgE antibody

Goat anti Human IgA

20-S11030GND1-D 5 mg
EUR 230.4
Description: Goat anti Human IgA antibody

Goat anti Human IgA

20-S1103GND1-D0 10 ml
EUR 230.4
Description: Goat anti Human IgA antibody

Goat anti Human IgA

20-S1111G000-S4 10 ml
EUR 159.6
Description: Goat anti Human IgA antibody

Goat anti Human IgA

20-S1111G000-V0 10 ml
EUR 159.6
Description: Goat anti Human IgA antibody

Goat anti Human IgA

20-S1111GOOO-S4 10 ml
EUR 159.6
Description: Goat anti Human IgA antibody

Goat anti Human IgM

20-S1303GND1-D0 10 ml
EUR 230.4
Description: Goat anti Human IgM antibody

Goat anti Human IgM

20-S1304GA01 5 ml
EUR 165.6
Description: Goat anti Human IgM antibody

Goat anti Human IgM

20-S1311G000-S4 10 ml
EUR 159.6
Description: Goat anti Human IgM antibody

Goat anti Human IgM

20-S1311G000-V0 10 ml
EUR 133.2
Description: Goat anti Human IgM antibody

Leave a Reply

Your email address will not be published.